SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374990648|ref|YP_004966143.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374990648|ref|YP_004966143.1|
Domain Number 1 Region: 10-157
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.63e-33
Family N-acetyl transferase, NAT 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374990648|ref|YP_004966143.1|
Sequence length 160
Comment hypothetical protein SBI_07892 [Streptomyces bingchenggensis BCW-1]
Sequence
MTYRIEVVGADALEACRGVRREVFVVEQRIPESEEMDEYDAHAVHLLATGPQGPTGTVRF
LHGAAADKKYGHAGVDGATTAVLGRLAVLPAARGTGLGADLVRAVEAEALRRGLAEVYLE
AQTHALGFYERLGYAAYGPEFDEGSGIPHRAMRRALQPRH
Download sequence
Identical sequences D7CEZ0
gi|374990648|ref|YP_004966143.1| WP_014180462.1.69245 WP_014180462.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]