SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374983645|ref|YP_004959140.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374983645|ref|YP_004959140.1|
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.57e-29
Family N-acetyl transferase, NAT 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374983645|ref|YP_004959140.1|
Sequence length 162
Comment putative acetyltransferase [Streptomyces bingchenggensis BCW-1]
Sequence
MLIREAAPRDWPAIWPFFHEIVAAGETFTYPLDLGEEQSREWWLLEPPNRTVVAVDEAGT
VLGTAKMNNNHMGNGAHIASASYMVDPAYSGQGVGRALCAYSLDWARAAGFRRMQFNAVV
ETNVHAVRLYRSLGFEVLGTLPEGFHHPTKGYVGLHIMHRAL
Download sequence
Identical sequences D7C621
WP_014173488.1.69245 WP_014173488.1.9551 gi|374983645|ref|YP_004959140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]