SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374986037|ref|YP_004961532.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374986037|ref|YP_004961532.1|
Domain Number 1 Region: 339-507
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 5.63e-30
Family Succinyl-CoA synthetase domains 0.00044
Further Details:      
 
Domain Number 2 Region: 207-339
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.35e-27
Family CoA-binding domain 0.00029
Further Details:      
 
Domain Number 3 Region: 24-175
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.32e-24
Family N-acetyl transferase, NAT 0.0084
Further Details:      
 
Domain Number 4 Region: 752-948
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.44e-23
Family BC ATP-binding domain-like 0.083
Further Details:      
 
Domain Number 5 Region: 508-672
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 6.54e-16
Family Succinyl-CoA synthetase domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374986037|ref|YP_004961532.1|
Sequence length 971
Comment acyl-CoA synthetase [Streptomyces bingchenggensis BCW-1]
Sequence
MRQPSDTHAYPAHWEADVVLRDGGTARIRPITADDAQRLVSFYERVSDESKYYRFFAPYP
RLSDRDVHRFTHHDYVDRVGLAATVGDEFIATVRYDRIDGQGLPSTAPADEAEVAFLVQD
AHQGRGVASALLEHIAAVARERGIRRFAAEVLPANTKMIKVFTDAGYTQKRSFEDGVVRL
EFDLEPTDRSLAVMRAREQRAEARSVQRLLAPGSVAVIGTGRAPGGVGRTVLRNLLDGGF
SGRVHAVNRAFPQEQDRLDPEGVPAHRSIHEIDGPVDLAIVAVPAAQVPSVVADCGDSGV
QSLVVVSAGYAESGPEGRDRQRELVRQARTYGMRIIGPNAFGVINTADGVRLNASLSPRL
PAPGRLGLFTQSGAIGIALLSGLDLRGAGTAGVSTFISAGNRADVSGNDVLQYWYDDPRT
DVALMYLESIGNPRKFTRLAKRTAAVKPVVVVKGARHSGSAPTGHAVPAPGIPDATVSAL
LRQAGVIRVDTVTELVDAGLLLASQPLPGGPRIAILGNSDSLGLLTYDACLTDGLRPLPP
RDLTTAAAPDDFRQALSAALADDACDAVVVTAIPGVGAAAAADLARAMRGAAAEAAARGA
AKPVAVVHLQIPGLAEALAEPWDAPGAGAEAAAGDDVADEAAFPAPRIPAYPAAERAVRA
LAEAVGYARWRRQAEEAGKTAQLPEYEDIDEAGAAADIDVLLAPTEGAPTEAASAEGAPA
DSAPRPQAADASPAASADAHAPYAVTLSAPDAQRLLARYGVSVLPALPAPDADAAVRGAA
RLGFPVALKTTAPHLRHRADLGGVRLDIGGEVELRRAYAELTDYLGAPEELRLVVQRMAP
RGVDTVVRAAIDPAAGAVLSFGLAGAPSELLGDTAHRLVPATDRDAAELIRSIRTAPLLF
GWRGSSPVDTAALEELLLRVSRMVDDHPEVVAVELEPVVVAPRGLSVLGAAVRLAPPPPR
TDLGPRHLPSY
Download sequence
Identical sequences D7C8L2
WP_014175878.1.69245 gi|374986037|ref|YP_004961532.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]