SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374986465|ref|YP_004961960.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374986465|ref|YP_004961960.1|
Domain Number 1 Region: 30-180
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.35e-25
Family N-acetyl transferase, NAT 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374986465|ref|YP_004961960.1|
Sequence length 193
Comment N-acetyltransferase GCN5 [Streptomyces bingchenggensis BCW-1]
Sequence
MTSSGTAEPVILSAMELMSDPDLAARFAESAHRILADLVRGGAALGWVEPPPRPEVAELL
GQVVATVRAGDGALRAAYLDRRLVGLGYWLRYARPTHRPHADLEKIAVDGAAHGRGIGRA
LTAALITDARRAGIEVLTLDARGDNTKALDLYRSLGFSEYGRLPDFVAVGERRYDKVFYM
IDFRRQDRTAPHS
Download sequence
Identical sequences D7CFS1
gi|374986465|ref|YP_004961960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]