SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374988305|ref|YP_004963800.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374988305|ref|YP_004963800.1|
Domain Number - Region: 107-153
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0204
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374988305|ref|YP_004963800.1|
Sequence length 271
Comment ABC transporter permease [Streptomyces bingchenggensis BCW-1]
Sequence
MSSTLSRPLSRPLSDSMTMLRRNLRHALRYPAMSISVLAMPIVMLLLFVYVFGGALGTGV
GPMGGAGGGDTDYIDYAAPGIILMAATSGSLAMAVAISVDMTAGIINRFRTMAISRSSVL
IGHVVGCVLQTLVAIALVTGLALAMGFRPNATAVEWLAVFGLLTLVTIALTWLSAAMGLV
CRSPETASNAPMPLQFLPFLGSAIVPTDSMPTGLRWFAEYQPYTPIIETLRGLLMGTEIG
NSGVIAVAWCVGLTLVGFLWARAMFKREPRH
Download sequence
Identical sequences D7CAV2
gi|374988305|ref|YP_004963800.1| WP_014178133.1.69245 WP_014178133.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]