SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374988725|ref|YP_004964220.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374988725|ref|YP_004964220.1|
Domain Number 1 Region: 147-293
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.1e-25
Family N-acetyl transferase, NAT 0.0049
Further Details:      
 
Domain Number 2 Region: 11-138
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.37e-22
Family MarR-like transcriptional regulators 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374988725|ref|YP_004964220.1|
Sequence length 296
Comment hypothetical protein SBI_05969 [Streptomyces bingchenggensis BCW-1]
Sequence
MDVAQIDQVRRFNRTVTERVGVLHDHYLGRDRPIGEARLLWEIGEQGQDVRRLRERLGLD
SGYVSRLLRALERDGLVTLEPHPEDRRVRTVRLTDAGRAERATLDRRSDELAGSLLEPLN
SAQRTRLVAAMAEVERLLTAATVTVDAVDPDHPDAQHCLRSYFTELQERFETGFDPARSL
LPDAGDFRPPHGLFLVARLHGEPVGCAGLKLPPTAPAEIKRMWVAPHTRGLGLARRFLAE
LETRAAEHGRDVLRLDTNKALDAAIGLYHSFGFQEVAAFNDEPYAHHWFEKRIGKD
Download sequence
Identical sequences D7CHN9
WP_014178551.1.69245 gi|374988725|ref|YP_004964220.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]