SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374989714|ref|YP_004965209.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374989714|ref|YP_004965209.1|
Domain Number 1 Region: 147-292
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.57e-24
Family N-acetyl transferase, NAT 0.0093
Further Details:      
 
Domain Number 2 Region: 12-141
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.87e-21
Family MarR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374989714|ref|YP_004965209.1|
Sequence length 308
Comment MarR family transcriptional regulator [Streptomyces bingchenggensis BCW-1]
Sequence
MSDDLDTTIDEVRAFNRLYTRLIGVLDYPGRLHTPYTLSEARILYELAQRERAHVSALRN
DLGLTAAHMSRTLGRFEEQGLITRERNVRDARHQQVSLTAEGRAAAAELDRKSRESVARL
LARLDRPQLRRLREALATTRGVFSGEQERVRLRGPGPGDLGWIVQRHGVLYAKEFGWNGE
FEALVARIVGEFGTDPGYERAWIAELGGRPVGSVLCVRDEAPETARLRLLLVEPDARGFG
IGDRLVGACVKFAREAGYRELVLWTNDVLTAARRIYQRAGFELIAERRHHSYGADLVGQD
WRLTLRGR
Download sequence
Identical sequences D7C1L3
gi|374989714|ref|YP_004965209.1| WP_014179528.1.69245 WP_014179528.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]