SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374990281|ref|YP_004965776.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374990281|ref|YP_004965776.1|
Domain Number 1 Region: 22-178
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.97e-25
Family N-acetyl transferase, NAT 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374990281|ref|YP_004965776.1|
Sequence length 194
Comment acetyltransferase [Streptomyces bingchenggensis BCW-1]
Sequence
MSTSTPRPRAPWTVAPRPVDDPVSAGLLRDYLVDVADRWYELYEGRSTTPEEIDKHLAEM
PSDDLAPPRGVFLVAHHDGELAGCAGVRLLDGGGTAEPGLRRTAELKRMFVRPAKRGLGA
GGVLLAAAEAAARELGAGRIVLETRLDLREARALYARHGYADVPPFCEGPYSEVWLGKEL
GEELGKELGDRITG
Download sequence
Identical sequences D7C9C7
gi|374990281|ref|YP_004965776.1| WP_014180095.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]