SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386618598|ref|YP_006138178.1| from Escherichia coli NA114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386618598|ref|YP_006138178.1|
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily YjgF-like 3.93e-34
Family YjgF/L-PSP 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386618598|ref|YP_006138178.1|
Sequence length 128
Comment Putative aminoacrylate peracid reductase [Escherichia coli NA114]
Sequence
MPKSVIIPAGSSAPLAPFVPGTLADGVVYVSGTLAFDQHNNVLFADDPKAQTRHVLETIR
KVIETAGGTMADVTFNSIFITDWKNYAAINEIYAEFFPGDKPARFCIQCGLVKPDALVEI
ATIAHIAK
Download sequence
Identical sequences A0A023YUM6 A0A024KT25 A0A025C8I9 A0A026UW13 A0A029I635 A0A029IXJ8 A0A064TMT2 A0A069XEQ2 A0A070FIZ7 A0A070SLE2 A0A070V0Q1 A0A073G069 A0A073HZU8 A0A073UHI4 A0A074I4G6 A0A080G237 A0A080J228 A0A090NGU5 A0A0E0V303 A0A0E1LXH8 A0A0E1T407 A0A0E2L6L8 A0A0G3K7K7 A0A0M7PH81 A0A125X6A9 A0A142H1N1 A0A192CM04 A0A1E2VI37 A0A1S6T9C3 A0A1X3I958 A0A1X3INQ1 A0A1X3JJW5 A0A1X3KJE2 A0A237F9N3 A0A237MEW6 A0A2D0NP19 A1A9R5 A7ZKB5 A7ZYW5 B1IV87 B1LIZ5 B1X9D1 B7M8Z5 B7MIF7 B7MTF3 B7NLB6 B7UNZ3 C4ZQD8 C6EHJ7 C6UFC1 C8U5H2 C9QZ66 D2NGI7 D3H123 D5CZH0 D6HV59 D6I8S6 D7XIY5 D7YAC6 D8A7P9 D8EB96 E1IPW8 E2XBE4 E3PJH9 E3XUN6 E6BD28 F4NDK1 F4SX88 F4TCP2 F4V0V5 F4VD41 F5NRA5 H4I996 H4ITX1 H4J657 H4KEQ3 H4LDX5 H4UGR4 I2RX10 I2WLY5 I2XK81 I4SAR8 L2XRV0 L3PA92 L3QAP2 L3QNZ2 L4JBM5 P0AFQ5 P0AFQ6 Q0TJ57 Q1RDK7 Q32HQ1 S0W5M9 S0Y2J8 S0Z8P5 S1DDX4 S1EQW7 S1H2K5 S1J1H9 S1PRQ4 T5VB97 T6ACG2 T6MDD4 T9EE26 U9XUP7 U9XY57 U9Z419 V0AG37 V0T114 V0XZF2 V2UUT0 V8KTJ7 W1ARE1 W8SPH8 W8ZPW1
gi|386633456|ref|YP_006153175.1| d3v4dc1 d3v4dd1 d3v4de1 gi|218700479|ref|YP_002408108.1| gi|170680387|ref|YP_001744166.1| gi|556551127|ref|YP_008721142.1| gi|387620738|ref|YP_006128365.1| gi|170080669|ref|YP_001729989.1| gi|82776296|ref|YP_402645.1| gi|157155569|ref|YP_001462244.1| gi|251784551|ref|YP_002998855.1| gi|110641193|ref|YP_668923.1| gi|251784551|ref|YP_002998855.1| NP_415530.1.90541 WP_001126780.1.100014 WP_001126780.1.100052 WP_001126780.1.100066 WP_001126780.1.100085 WP_001126780.1.100111 WP_001126780.1.100138 WP_001126780.1.100151 WP_001126780.1.100159 WP_001126780.1.100227 WP_001126780.1.100251 WP_001126780.1.100252 WP_001126780.1.100281 WP_001126780.1.100283 WP_001126780.1.100285 WP_001126780.1.100304 WP_001126780.1.100306 WP_001126780.1.10034 WP_001126780.1.100346 WP_001126780.1.100441 WP_001126780.1.100444 WP_001126780.1.100474 WP_001126780.1.100487 WP_001126780.1.100496 WP_001126780.1.10051 WP_001126780.1.100573 WP_001126780.1.100667 WP_001126780.1.10067 WP_001126780.1.100685 WP_001126780.1.100688 WP_001126780.1.100689 WP_001126780.1.100718 WP_001126780.1.100735 WP_001126780.1.100738 WP_001126780.1.100778 WP_001126780.1.100803 WP_001126780.1.100824 WP_001126780.1.100898 WP_001126780.1.10094 WP_001126780.1.100950 WP_001126780.1.100959 WP_001126780.1.100966 WP_001126780.1.100990 WP_001126780.1.101033 WP_001126780.1.101052 WP_001126780.1.101087 WP_001126780.1.101096 WP_001126780.1.101110 WP_001126780.1.101148 WP_001126780.1.101152 WP_001126780.1.101158 WP_001126780.1.101186 WP_001126780.1.101255 WP_001126780.1.101257 WP_001126780.1.10126 WP_001126780.1.101293 WP_001126780.1.10138 WP_001126780.1.101399 WP_001126780.1.101423 WP_001126780.1.101430 WP_001126780.1.101445 WP_001126780.1.101583 WP_001126780.1.101586 WP_001126780.1.101654 WP_001126780.1.101693 WP_001126780.1.101694 WP_001126780.1.101700 WP_001126780.1.101727 WP_001126780.1.10173 WP_001126780.1.101769 WP_001126780.1.10181 WP_001126780.1.101822 WP_001126780.1.10184 WP_001126780.1.101855 WP_001126780.1.101865 WP_001126780.1.10188 WP_001126780.1.10190 WP_001126780.1.101926 WP_001126780.1.101932 WP_001126780.1.101947 WP_001126780.1.101948 WP_001126780.1.101964 WP_001126780.1.101984 WP_001126780.1.102104 WP_001126780.1.102106 WP_001126780.1.102144 WP_001126780.1.10233 WP_001126780.1.10235 WP_001126780.1.10252 WP_001126780.1.10304 WP_001126780.1.10326 WP_001126780.1.10379 WP_001126780.1.1040 WP_001126780.1.10417 WP_001126780.1.10491 WP_001126780.1.10492 WP_001126780.1.10496 WP_001126780.1.10524 WP_001126780.1.10569 WP_001126780.1.10573 WP_001126780.1.1058 WP_001126780.1.10673 WP_001126780.1.10697 WP_001126780.1.10705 WP_001126780.1.1073 WP_001126780.1.1074 WP_001126780.1.10744 WP_001126780.1.10748 WP_001126780.1.10786 WP_001126780.1.10787 WP_001126780.1.10814 WP_001126780.1.10824 WP_001126780.1.10833 WP_001126780.1.10842 WP_001126780.1.10849 WP_001126780.1.10869 WP_001126780.1.10922 WP_001126780.1.10989 WP_001126780.1.11006 WP_001126780.1.11032 WP_001126780.1.11047 WP_001126780.1.11052 WP_001126780.1.11057 WP_001126780.1.11068 WP_001126780.1.11071 WP_001126780.1.11091 WP_001126780.1.11113 WP_001126780.1.11118 WP_001126780.1.11121 WP_001126780.1.1113 WP_001126780.1.11133 WP_001126780.1.112 WP_001126780.1.11217 WP_001126780.1.1122 WP_001126780.1.11250 WP_001126780.1.11285 WP_001126780.1.11315 WP_001126780.1.11399 WP_001126780.1.11408 WP_001126780.1.11411 WP_001126780.1.11418 WP_001126780.1.11437 WP_001126780.1.11519 WP_001126780.1.11524 WP_001126780.1.11531 WP_001126780.1.11542 WP_001126780.1.11575 WP_001126780.1.11607 WP_001126780.1.11608 WP_001126780.1.11612 WP_001126780.1.11699 WP_001126780.1.11748 WP_001126780.1.11803 WP_001126780.1.11844 WP_001126780.1.1186 WP_001126780.1.11955 WP_001126780.1.11956 WP_001126780.1.11981 WP_001126780.1.11982 WP_001126780.1.11985 WP_001126780.1.12009 WP_001126780.1.12010 WP_001126780.1.12030 WP_001126780.1.12036 WP_001126780.1.12050 WP_001126780.1.12076 WP_001126780.1.12088 WP_001126780.1.12111 WP_001126780.1.1212 WP_001126780.1.12151 WP_001126780.1.12157 WP_001126780.1.12174 WP_001126780.1.12268 WP_001126780.1.12279 WP_001126780.1.12295 WP_001126780.1.12319 WP_001126780.1.12320 WP_001126780.1.12415 WP_001126780.1.12468 WP_001126780.1.12478 WP_001126780.1.12542 WP_001126780.1.12558 WP_001126780.1.12566 WP_001126780.1.12582 WP_001126780.1.12594 WP_001126780.1.12646 WP_001126780.1.12675 WP_001126780.1.12679 WP_001126780.1.12693 WP_001126780.1.127 WP_001126780.1.12756 WP_001126780.1.12761 WP_001126780.1.12763 WP_001126780.1.12766 WP_001126780.1.12826 WP_001126780.1.12830 WP_001126780.1.12831 WP_001126780.1.12876 WP_001126780.1.12893 WP_001126780.1.12911 WP_001126780.1.12914 WP_001126780.1.12915 WP_001126780.1.12944 WP_001126780.1.12956 WP_001126780.1.12976 WP_001126780.1.12991 WP_001126780.1.13002 WP_001126780.1.13015 WP_001126780.1.13031 WP_001126780.1.1312 WP_001126780.1.1314 WP_001126780.1.13162 WP_001126780.1.13176 WP_001126780.1.13181 WP_001126780.1.1323 WP_001126780.1.13239 WP_001126780.1.13252 WP_001126780.1.13271 WP_001126780.1.13272 WP_001126780.1.13281 WP_001126780.1.13333 WP_001126780.1.1335 WP_001126780.1.1343 WP_001126780.1.13437 WP_001126780.1.1345 WP_001126780.1.13451 WP_001126780.1.13469 WP_001126780.1.13473 WP_001126780.1.13525 WP_001126780.1.13585 WP_001126780.1.13601 WP_001126780.1.13608 WP_001126780.1.13618 WP_001126780.1.13626 WP_001126780.1.13662 WP_001126780.1.13664 WP_001126780.1.13672 WP_001126780.1.13778 WP_001126780.1.13791 WP_001126780.1.13824 WP_001126780.1.13877 WP_001126780.1.13924 WP_001126780.1.13934 WP_001126780.1.13944 WP_001126780.1.13949 WP_001126780.1.13974 WP_001126780.1.14070 WP_001126780.1.14144 WP_001126780.1.14245 WP_001126780.1.14292 WP_001126780.1.14331 WP_001126780.1.14346 WP_001126780.1.14371 WP_001126780.1.1438 WP_001126780.1.14389 WP_001126780.1.14398 WP_001126780.1.14417 WP_001126780.1.14432 WP_001126780.1.14445 WP_001126780.1.14468 WP_001126780.1.14501 WP_001126780.1.14506 WP_001126780.1.14508 WP_001126780.1.14509 WP_001126780.1.14529 WP_001126780.1.14536 WP_001126780.1.14538 WP_001126780.1.14581 WP_001126780.1.14600 WP_001126780.1.14601 WP_001126780.1.14607 WP_001126780.1.1461 WP_001126780.1.14616 WP_001126780.1.14661 WP_001126780.1.14672 WP_001126780.1.14678 WP_001126780.1.14687 WP_001126780.1.1470 WP_001126780.1.14712 WP_001126780.1.14749 WP_001126780.1.14807 WP_001126780.1.14811 WP_001126780.1.14833 WP_001126780.1.14871 WP_001126780.1.14914 WP_001126780.1.14934 WP_001126780.1.14935 WP_001126780.1.14956 WP_001126780.1.14963 WP_001126780.1.14992 WP_001126780.1.14993 WP_001126780.1.15020 WP_001126780.1.15087 WP_001126780.1.1512 WP_001126780.1.15121 WP_001126780.1.15177 WP_001126780.1.15207 WP_001126780.1.15221 WP_001126780.1.15259 WP_001126780.1.15274 WP_001126780.1.15277 WP_001126780.1.15290 WP_001126780.1.15300 WP_001126780.1.15304 WP_001126780.1.15416 WP_001126780.1.15420 WP_001126780.1.15444 WP_001126780.1.15453 WP_001126780.1.15464 WP_001126780.1.15469 WP_001126780.1.15496 WP_001126780.1.15538 WP_001126780.1.15576 WP_001126780.1.15624 WP_001126780.1.15645 WP_001126780.1.15654 WP_001126780.1.15740 WP_001126780.1.15747 WP_001126780.1.15752 WP_001126780.1.15791 WP_001126780.1.15857 WP_001126780.1.15863 WP_001126780.1.15869 WP_001126780.1.1588 WP_001126780.1.15949 WP_001126780.1.15983 WP_001126780.1.15984 WP_001126780.1.15990 WP_001126780.1.16014 WP_001126780.1.16034 WP_001126780.1.1604 WP_001126780.1.16067 WP_001126780.1.16086 WP_001126780.1.1609 WP_001126780.1.16111 WP_001126780.1.16154 WP_001126780.1.16171 WP_001126780.1.16175 WP_001126780.1.16179 WP_001126780.1.16194 WP_001126780.1.1621 WP_001126780.1.1622 WP_001126780.1.16270 WP_001126780.1.16294 WP_001126780.1.163 WP_001126780.1.16322 WP_001126780.1.1634 WP_001126780.1.16387 WP_001126780.1.16396 WP_001126780.1.16500 WP_001126780.1.16532 WP_001126780.1.16541 WP_001126780.1.1655 WP_001126780.1.16577 WP_001126780.1.16608 WP_001126780.1.16612 WP_001126780.1.16648 WP_001126780.1.16667 WP_001126780.1.16705 WP_001126780.1.16715 WP_001126780.1.16721 WP_001126780.1.16752 WP_001126780.1.16766 WP_001126780.1.16780 WP_001126780.1.16798 WP_001126780.1.16807 WP_001126780.1.16818 WP_001126780.1.17014 WP_001126780.1.17018 WP_001126780.1.17028 WP_001126780.1.17084 WP_001126780.1.17087 WP_001126780.1.17102 WP_001126780.1.17109 WP_001126780.1.17111 WP_001126780.1.17114 WP_001126780.1.17119 WP_001126780.1.17150 WP_001126780.1.17153 WP_001126780.1.17170 WP_001126780.1.17206 WP_001126780.1.17267 WP_001126780.1.17282 WP_001126780.1.17290 WP_001126780.1.17297 WP_001126780.1.17325 WP_001126780.1.17333 WP_001126780.1.17356 WP_001126780.1.17360 WP_001126780.1.17373 WP_001126780.1.17387 WP_001126780.1.17392 WP_001126780.1.17417 WP_001126780.1.17432 WP_001126780.1.17461 WP_001126780.1.17534 WP_001126780.1.1754 WP_001126780.1.17584 WP_001126780.1.1763 WP_001126780.1.1766 WP_001126780.1.17701 WP_001126780.1.17757 WP_001126780.1.17769 WP_001126780.1.17802 WP_001126780.1.17829 WP_001126780.1.17831 WP_001126780.1.17849 WP_001126780.1.17889 WP_001126780.1.17920 WP_001126780.1.17925 WP_001126780.1.17937 WP_001126780.1.17952 WP_001126780.1.17961 WP_001126780.1.18000 WP_001126780.1.18006 WP_001126780.1.1802 WP_001126780.1.18024 WP_001126780.1.18050 WP_001126780.1.18064 WP_001126780.1.18094 WP_001126780.1.18133 WP_001126780.1.18134 WP_001126780.1.18226 WP_001126780.1.18275 WP_001126780.1.18316 WP_001126780.1.18329 WP_001126780.1.18337 WP_001126780.1.18348 WP_001126780.1.18381 WP_001126780.1.18394 WP_001126780.1.18402 WP_001126780.1.18420 WP_001126780.1.1844 WP_001126780.1.18461 WP_001126780.1.18472 WP_001126780.1.18482 WP_001126780.1.18519 WP_001126780.1.18530 WP_001126780.1.18550 WP_001126780.1.18556 WP_001126780.1.18588 WP_001126780.1.18617 WP_001126780.1.1862 WP_001126780.1.18649 WP_001126780.1.18650 WP_001126780.1.18651 WP_001126780.1.18655 WP_001126780.1.1866 WP_001126780.1.18714 WP_001126780.1.18725 WP_001126780.1.18726 WP_001126780.1.18734 WP_001126780.1.18794 WP_001126780.1.188 WP_001126780.1.18801 WP_001126780.1.18802 WP_001126780.1.18828 WP_001126780.1.18861 WP_001126780.1.18874 WP_001126780.1.18876 WP_001126780.1.18899 WP_001126780.1.18908 WP_001126780.1.18923 WP_001126780.1.18929 WP_001126780.1.18934 WP_001126780.1.18936 WP_001126780.1.1896 WP_001126780.1.18962 WP_001126780.1.18966 WP_001126780.1.19036 WP_001126780.1.1906 WP_001126780.1.19075 WP_001126780.1.1909 WP_001126780.1.19100 WP_001126780.1.19114 WP_001126780.1.19135 WP_001126780.1.19146 WP_001126780.1.19150 WP_001126780.1.19153 WP_001126780.1.19171 WP_001126780.1.19205 WP_001126780.1.19206 WP_001126780.1.19245 WP_001126780.1.1925 WP_001126780.1.19277 WP_001126780.1.19297 WP_001126780.1.193 WP_001126780.1.19313 WP_001126780.1.19361 WP_001126780.1.19374 WP_001126780.1.19379 WP_001126780.1.19397 WP_001126780.1.19441 WP_001126780.1.19448 WP_001126780.1.19465 WP_001126780.1.19478 WP_001126780.1.19492 WP_001126780.1.19534 WP_001126780.1.19547 WP_001126780.1.19557 WP_001126780.1.19593 WP_001126780.1.1960 WP_001126780.1.1963 WP_001126780.1.19654 WP_001126780.1.19655 WP_001126780.1.19661 WP_001126780.1.19691 WP_001126780.1.19760 WP_001126780.1.19761 WP_001126780.1.19778 WP_001126780.1.19795 WP_001126780.1.1982 WP_001126780.1.19861 WP_001126780.1.1987 WP_001126780.1.19878 WP_001126780.1.19889 WP_001126780.1.19957 WP_001126780.1.19972 WP_001126780.1.19994 WP_001126780.1.20115 WP_001126780.1.20151 WP_001126780.1.20164 WP_001126780.1.20166 WP_001126780.1.20170 WP_001126780.1.20183 WP_001126780.1.20224 WP_001126780.1.20238 WP_001126780.1.20251 WP_001126780.1.2027 WP_001126780.1.20308 WP_001126780.1.20318 WP_001126780.1.20325 WP_001126780.1.20331 WP_001126780.1.20388 WP_001126780.1.20445 WP_001126780.1.20452 WP_001126780.1.20493 WP_001126780.1.20506 WP_001126780.1.20515 WP_001126780.1.20519 WP_001126780.1.20536 WP_001126780.1.20549 WP_001126780.1.20565 WP_001126780.1.20575 WP_001126780.1.20596 WP_001126780.1.20609 WP_001126780.1.2063 WP_001126780.1.20630 WP_001126780.1.20638 WP_001126780.1.20640 WP_001126780.1.20662 WP_001126780.1.20691 WP_001126780.1.20709 WP_001126780.1.20724 WP_001126780.1.20741 WP_001126780.1.20761 WP_001126780.1.20765 WP_001126780.1.20784 WP_001126780.1.20785 WP_001126780.1.20803 WP_001126780.1.20818 WP_001126780.1.20824 WP_001126780.1.20841 WP_001126780.1.20863 WP_001126780.1.2092 WP_001126780.1.20933 WP_001126780.1.20943 WP_001126780.1.20958 WP_001126780.1.20962 WP_001126780.1.20982 WP_001126780.1.2100 WP_001126780.1.21017 WP_001126780.1.21020 WP_001126780.1.21029 WP_001126780.1.21033 WP_001126780.1.21057 WP_001126780.1.21104 WP_001126780.1.21122 WP_001126780.1.21152 WP_001126780.1.21236 WP_001126780.1.21248 WP_001126780.1.21251 WP_001126780.1.21266 WP_001126780.1.21320 WP_001126780.1.21336 WP_001126780.1.21378 WP_001126780.1.2142 WP_001126780.1.21455 WP_001126780.1.21470 WP_001126780.1.21519 WP_001126780.1.21526 WP_001126780.1.21537 WP_001126780.1.2156 WP_001126780.1.21573 WP_001126780.1.21596 WP_001126780.1.21628 WP_001126780.1.21634 WP_001126780.1.21652 WP_001126780.1.21661 WP_001126780.1.21696 WP_001126780.1.21714 WP_001126780.1.21729 WP_001126780.1.21733 WP_001126780.1.21756 WP_001126780.1.21758 WP_001126780.1.21771 WP_001126780.1.21773 WP_001126780.1.21812 WP_001126780.1.21823 WP_001126780.1.21887 WP_001126780.1.21899 WP_001126780.1.21915 WP_001126780.1.21945 WP_001126780.1.21948 WP_001126780.1.22021 WP_001126780.1.22042 WP_001126780.1.22088 WP_001126780.1.22113 WP_001126780.1.22138 WP_001126780.1.22161 WP_001126780.1.22189 WP_001126780.1.22195 WP_001126780.1.22203 WP_001126780.1.22269 WP_001126780.1.22272 WP_001126780.1.22280 WP_001126780.1.22293 WP_001126780.1.22314 WP_001126780.1.22359 WP_001126780.1.22363 WP_001126780.1.2242 WP_001126780.1.2245 WP_001126780.1.22464 WP_001126780.1.22494 WP_001126780.1.22508 WP_001126780.1.22543 WP_001126780.1.22549 WP_001126780.1.22574 WP_001126780.1.22576 WP_001126780.1.22579 WP_001126780.1.22599 WP_001126780.1.22602 WP_001126780.1.22631 WP_001126780.1.22649 WP_001126780.1.22667 WP_001126780.1.22669 WP_001126780.1.22691 WP_001126780.1.22757 WP_001126780.1.22759 WP_001126780.1.22777 WP_001126780.1.22783 WP_001126780.1.22824 WP_001126780.1.22830 WP_001126780.1.22885 WP_001126780.1.22908 WP_001126780.1.22917 WP_001126780.1.22939 WP_001126780.1.22993 WP_001126780.1.23021 WP_001126780.1.23026 WP_001126780.1.23035 WP_001126780.1.23044 WP_001126780.1.23090 WP_001126780.1.23092 WP_001126780.1.23109 WP_001126780.1.2322 WP_001126780.1.23230 WP_001126780.1.23282 WP_001126780.1.23330 WP_001126780.1.23378 WP_001126780.1.23435 WP_001126780.1.23511 WP_001126780.1.23520 WP_001126780.1.23522 WP_001126780.1.23549 WP_001126780.1.23575 WP_001126780.1.2362 WP_001126780.1.23625 WP_001126780.1.23676 WP_001126780.1.23686 WP_001126780.1.23700 WP_001126780.1.23711 WP_001126780.1.23724 WP_001126780.1.23804 WP_001126780.1.23812 WP_001126780.1.23840 WP_001126780.1.23855 WP_001126780.1.23890 WP_001126780.1.23898 WP_001126780.1.23915 WP_001126780.1.23945 WP_001126780.1.23953 WP_001126780.1.23962 WP_001126780.1.23970 WP_001126780.1.23985 WP_001126780.1.24004 WP_001126780.1.24038 WP_001126780.1.24045 WP_001126780.1.24068 WP_001126780.1.24088 WP_001126780.1.24122 WP_001126780.1.24124 WP_001126780.1.24127 WP_001126780.1.24136 WP_001126780.1.24169 WP_001126780.1.24177 WP_001126780.1.2418 WP_001126780.1.24233 WP_001126780.1.24278 WP_001126780.1.2428 WP_001126780.1.24304 WP_001126780.1.24316 WP_001126780.1.24362 WP_001126780.1.24374 WP_001126780.1.24383 WP_001126780.1.2449 WP_001126780.1.24499 WP_001126780.1.24523 WP_001126780.1.24524 WP_001126780.1.24583 WP_001126780.1.24616 WP_001126780.1.24634 WP_001126780.1.24641 WP_001126780.1.24642 WP_001126780.1.24650 WP_001126780.1.2469 WP_001126780.1.24693 WP_001126780.1.24695 WP_001126780.1.24703 WP_001126780.1.24752 WP_001126780.1.24758 WP_001126780.1.24763 WP_001126780.1.24773 WP_001126780.1.2479 WP_001126780.1.24797 WP_001126780.1.24808 WP_001126780.1.24854 WP_001126780.1.24906 WP_001126780.1.24909 WP_001126780.1.24946 WP_001126780.1.24960 WP_001126780.1.24968 WP_001126780.1.24979 WP_001126780.1.2502 WP_001126780.1.25021 WP_001126780.1.25039 WP_001126780.1.2504 WP_001126780.1.25042 WP_001126780.1.25079 WP_001126780.1.25085 WP_001126780.1.25086 WP_001126780.1.2512 WP_001126780.1.25126 WP_001126780.1.25174 WP_001126780.1.25183 WP_001126780.1.25193 WP_001126780.1.25203 WP_001126780.1.25248 WP_001126780.1.25270 WP_001126780.1.25272 WP_001126780.1.2531 WP_001126780.1.25312 WP_001126780.1.25324 WP_001126780.1.25372 WP_001126780.1.25380 WP_001126780.1.25414 WP_001126780.1.25420 WP_001126780.1.25446 WP_001126780.1.25480 WP_001126780.1.25548 WP_001126780.1.2558 WP_001126780.1.25612 WP_001126780.1.2567 WP_001126780.1.25680 WP_001126780.1.25701 WP_001126780.1.25712 WP_001126780.1.25713 WP_001126780.1.25724 WP_001126780.1.25750 WP_001126780.1.25843 WP_001126780.1.25869 WP_001126780.1.25873 WP_001126780.1.25895 WP_001126780.1.2597 WP_001126780.1.26040 WP_001126780.1.26048 WP_001126780.1.26055 WP_001126780.1.2606 WP_001126780.1.26061 WP_001126780.1.26076 WP_001126780.1.26092 WP_001126780.1.26100 WP_001126780.1.26131 WP_001126780.1.26175 WP_001126780.1.26189 WP_001126780.1.26259 WP_001126780.1.26264 WP_001126780.1.26284 WP_001126780.1.26304 WP_001126780.1.26331 WP_001126780.1.26379 WP_001126780.1.26398 WP_001126780.1.26403 WP_001126780.1.26479 WP_001126780.1.26480 WP_001126780.1.26517 WP_001126780.1.26569 WP_001126780.1.26579 WP_001126780.1.26598 WP_001126780.1.26609 WP_001126780.1.26627 WP_001126780.1.2665 WP_001126780.1.26659 WP_001126780.1.26660 WP_001126780.1.26683 WP_001126780.1.26688 WP_001126780.1.26716 WP_001126780.1.26720 WP_001126780.1.26736 WP_001126780.1.26782 WP_001126780.1.26837 WP_001126780.1.26861 WP_001126780.1.2688 WP_001126780.1.26941 WP_001126780.1.26943 WP_001126780.1.2695 WP_001126780.1.26950 WP_001126780.1.26987 WP_001126780.1.26995 WP_001126780.1.2700 WP_001126780.1.27043 WP_001126780.1.27057 WP_001126780.1.27091 WP_001126780.1.27098 WP_001126780.1.27134 WP_001126780.1.27141 WP_001126780.1.27175 WP_001126780.1.27188 WP_001126780.1.27214 WP_001126780.1.27234 WP_001126780.1.27260 WP_001126780.1.27310 WP_001126780.1.27313 WP_001126780.1.27330 WP_001126780.1.27401 WP_001126780.1.2745 WP_001126780.1.27451 WP_001126780.1.27518 WP_001126780.1.27520 WP_001126780.1.27524 WP_001126780.1.2755 WP_001126780.1.27560 WP_001126780.1.27580 WP_001126780.1.27611 WP_001126780.1.27618 WP_001126780.1.27691 WP_001126780.1.27693 WP_001126780.1.27723 WP_001126780.1.27741 WP_001126780.1.27774 WP_001126780.1.2779 WP_001126780.1.27797 WP_001126780.1.2782 WP_001126780.1.27846 WP_001126780.1.27861 WP_001126780.1.27871 WP_001126780.1.27879 WP_001126780.1.27913 WP_001126780.1.27923 WP_001126780.1.27932 WP_001126780.1.2794 WP_001126780.1.27971 WP_001126780.1.27998 WP_001126780.1.28008 WP_001126780.1.28026 WP_001126780.1.28051 WP_001126780.1.28109 WP_001126780.1.2811 WP_001126780.1.28128 WP_001126780.1.28156 WP_001126780.1.28167 WP_001126780.1.28184 WP_001126780.1.2823 WP_001126780.1.2826 WP_001126780.1.28268 WP_001126780.1.28271 WP_001126780.1.28305 WP_001126780.1.28318 WP_001126780.1.28322 WP_001126780.1.28345 WP_001126780.1.28349 WP_001126780.1.28371 WP_001126780.1.28461 WP_001126780.1.28476 WP_001126780.1.28480 WP_001126780.1.285 WP_001126780.1.28500 WP_001126780.1.28523 WP_001126780.1.28568 WP_001126780.1.2866 WP_001126780.1.28662 WP_001126780.1.28697 WP_001126780.1.28711 WP_001126780.1.28732 WP_001126780.1.28736 WP_001126780.1.28742 WP_001126780.1.28809 WP_001126780.1.28829 WP_001126780.1.28842 WP_001126780.1.28919 WP_001126780.1.28924 WP_001126780.1.28953 WP_001126780.1.28982 WP_001126780.1.28994 WP_001126780.1.29001 WP_001126780.1.29013 WP_001126780.1.29026 WP_001126780.1.29061 WP_001126780.1.29100 WP_001126780.1.29118 WP_001126780.1.29128 WP_001126780.1.29150 WP_001126780.1.29164 WP_001126780.1.29176 WP_001126780.1.29194 WP_001126780.1.29202 WP_001126780.1.29221 WP_001126780.1.29258 WP_001126780.1.2926 WP_001126780.1.29341 WP_001126780.1.29377 WP_001126780.1.29429 WP_001126780.1.29443 WP_001126780.1.2945 WP_001126780.1.29486 WP_001126780.1.29497 WP_001126780.1.29503 WP_001126780.1.29513 WP_001126780.1.2954 WP_001126780.1.29590 WP_001126780.1.29603 WP_001126780.1.29647 WP_001126780.1.29662 WP_001126780.1.29683 WP_001126780.1.29689 WP_001126780.1.29715 WP_001126780.1.29724 WP_001126780.1.29746 WP_001126780.1.29812 WP_001126780.1.29815 WP_001126780.1.29819 WP_001126780.1.29820 WP_001126780.1.29821 WP_001126780.1.29840 WP_001126780.1.29855 WP_001126780.1.29884 WP_001126780.1.29979 WP_001126780.1.29988 WP_001126780.1.29992 WP_001126780.1.30063 WP_001126780.1.30098 WP_001126780.1.30105 WP_001126780.1.3018 WP_001126780.1.30232 WP_001126780.1.30239 WP_001126780.1.30247 WP_001126780.1.30269 WP_001126780.1.30298 WP_001126780.1.30391 WP_001126780.1.30400 WP_001126780.1.3045 WP_001126780.1.30452 WP_001126780.1.30472 WP_001126780.1.30479 WP_001126780.1.30497 WP_001126780.1.30524 WP_001126780.1.30536 WP_001126780.1.30546 WP_001126780.1.3055 WP_001126780.1.30550 WP_001126780.1.30554 WP_001126780.1.30570 WP_001126780.1.306 WP_001126780.1.30639 WP_001126780.1.30658 WP_001126780.1.30665 WP_001126780.1.30691 WP_001126780.1.30733 WP_001126780.1.30749 WP_001126780.1.30762 WP_001126780.1.3083 WP_001126780.1.30843 WP_001126780.1.30866 WP_001126780.1.30867 WP_001126780.1.30879 WP_001126780.1.30887 WP_001126780.1.30896 WP_001126780.1.309 WP_001126780.1.30905 WP_001126780.1.30906 WP_001126780.1.30987 WP_001126780.1.31017 WP_001126780.1.31083 WP_001126780.1.31089 WP_001126780.1.31119 WP_001126780.1.31129 WP_001126780.1.31142 WP_001126780.1.31188 WP_001126780.1.31211 WP_001126780.1.31295 WP_001126780.1.31379 WP_001126780.1.31407 WP_001126780.1.31419 WP_001126780.1.31421 WP_001126780.1.31422 WP_001126780.1.31431 WP_001126780.1.3147 WP_001126780.1.31506 WP_001126780.1.31511 WP_001126780.1.31557 WP_001126780.1.31559 WP_001126780.1.31596 WP_001126780.1.31614 WP_001126780.1.31657 WP_001126780.1.31675 WP_001126780.1.31681 WP_001126780.1.31709 WP_001126780.1.31740 WP_001126780.1.31803 WP_001126780.1.31823 WP_001126780.1.31833 WP_001126780.1.31835 WP_001126780.1.31839 WP_001126780.1.31860 WP_001126780.1.31863 WP_001126780.1.31898 WP_001126780.1.31928 WP_001126780.1.3193 WP_001126780.1.31978 WP_001126780.1.3201 WP_001126780.1.32020 WP_001126780.1.32021 WP_001126780.1.32024 WP_001126780.1.3203 WP_001126780.1.32030 WP_001126780.1.32037 WP_001126780.1.32091 WP_001126780.1.32093 WP_001126780.1.3212 WP_001126780.1.32121 WP_001126780.1.32127 WP_001126780.1.32138 WP_001126780.1.32184 WP_001126780.1.32222 WP_001126780.1.32225 WP_001126780.1.32232 WP_001126780.1.3233 WP_001126780.1.32406 WP_001126780.1.32432 WP_001126780.1.32478 WP_001126780.1.32479 WP_001126780.1.3248 WP_001126780.1.32494 WP_001126780.1.32509 WP_001126780.1.32518 WP_001126780.1.32558 WP_001126780.1.32587 WP_001126780.1.3259 WP_001126780.1.32591 WP_001126780.1.32601 WP_001126780.1.32650 WP_001126780.1.32676 WP_001126780.1.32680 WP_001126780.1.3269 WP_001126780.1.32709 WP_001126780.1.32718 WP_001126780.1.32722 WP_001126780.1.32748 WP_001126780.1.32811 WP_001126780.1.32875 WP_001126780.1.32903 WP_001126780.1.32910 WP_001126780.1.32984 WP_001126780.1.32992 WP_001126780.1.33004 WP_001126780.1.33014 WP_001126780.1.33018 WP_001126780.1.33026 WP_001126780.1.33046 WP_001126780.1.33179 WP_001126780.1.33190 WP_001126780.1.33217 WP_001126780.1.33238 WP_001126780.1.33244 WP_001126780.1.33303 WP_001126780.1.33325 WP_001126780.1.33352 WP_001126780.1.33385 WP_001126780.1.334 WP_001126780.1.33408 WP_001126780.1.33410 WP_001126780.1.33424 WP_001126780.1.33428 WP_001126780.1.3344 WP_001126780.1.33475 WP_001126780.1.33476 WP_001126780.1.33502 WP_001126780.1.33512 WP_001126780.1.33525 WP_001126780.1.33526 WP_001126780.1.33545 WP_001126780.1.33563 WP_001126780.1.33565 WP_001126780.1.33595 WP_001126780.1.33631 WP_001126780.1.33648 WP_001126780.1.33736 WP_001126780.1.33746 WP_001126780.1.33751 WP_001126780.1.33799 WP_001126780.1.33854 WP_001126780.1.33879 WP_001126780.1.33888 WP_001126780.1.33948 WP_001126780.1.33952 WP_001126780.1.33973 WP_001126780.1.33974 WP_001126780.1.3398 WP_001126780.1.3401 WP_001126780.1.34094 WP_001126780.1.3411 WP_001126780.1.34121 WP_001126780.1.34124 WP_001126780.1.34130 WP_001126780.1.342 WP_001126780.1.34204 WP_001126780.1.34206 WP_001126780.1.34208 WP_001126780.1.34270 WP_001126780.1.34294 WP_001126780.1.34303 WP_001126780.1.3432 WP_001126780.1.34332 WP_001126780.1.34362 WP_001126780.1.34363 WP_001126780.1.3439 WP_001126780.1.34400 WP_001126780.1.34422 WP_001126780.1.34444 WP_001126780.1.34456 WP_001126780.1.34525 WP_001126780.1.34528 WP_001126780.1.34532 WP_001126780.1.34538 WP_001126780.1.3460 WP_001126780.1.34605 WP_001126780.1.34617 WP_001126780.1.34682 WP_001126780.1.34683 WP_001126780.1.3469 WP_001126780.1.34727 WP_001126780.1.34794 WP_001126780.1.34835 WP_001126780.1.34875 WP_001126780.1.34887 WP_001126780.1.34913 WP_001126780.1.34931 WP_001126780.1.34966 WP_001126780.1.34982 WP_001126780.1.34990 WP_001126780.1.34993 WP_001126780.1.35003 WP_001126780.1.35007 WP_001126780.1.35012 WP_001126780.1.35107 WP_001126780.1.35114 WP_001126780.1.35127 WP_001126780.1.3515 WP_001126780.1.35195 WP_001126780.1.35198 WP_001126780.1.35202 WP_001126780.1.35208 WP_001126780.1.35211 WP_001126780.1.35220 WP_001126780.1.35253 WP_001126780.1.35258 WP_001126780.1.35349 WP_001126780.1.35360 WP_001126780.1.35376 WP_001126780.1.35394 WP_001126780.1.35448 WP_001126780.1.35464 WP_001126780.1.35466 WP_001126780.1.35483 WP_001126780.1.35578 WP_001126780.1.35627 WP_001126780.1.35632 WP_001126780.1.35651 WP_001126780.1.35704 WP_001126780.1.35724 WP_001126780.1.35740 WP_001126780.1.35741 WP_001126780.1.35744 WP_001126780.1.35789 WP_001126780.1.35889 WP_001126780.1.35904 WP_001126780.1.35922 WP_001126780.1.35934 WP_001126780.1.35942 WP_001126780.1.35959 WP_001126780.1.35963 WP_001126780.1.35987 WP_001126780.1.36070 WP_001126780.1.36071 WP_001126780.1.36094 WP_001126780.1.36132 WP_001126780.1.36158 WP_001126780.1.36164 WP_001126780.1.3620 WP_001126780.1.36207 WP_001126780.1.3624 WP_001126780.1.36334 WP_001126780.1.36386 WP_001126780.1.36405 WP_001126780.1.36414 WP_001126780.1.36426 WP_001126780.1.3643 WP_001126780.1.36459 WP_001126780.1.36496 WP_001126780.1.365 WP_001126780.1.36507 WP_001126780.1.36523 WP_001126780.1.36531 WP_001126780.1.36545 WP_001126780.1.36610 WP_001126780.1.36667 WP_001126780.1.36699 WP_001126780.1.36707 WP_001126780.1.3671 WP_001126780.1.36739 WP_001126780.1.36746 WP_001126780.1.36747 WP_001126780.1.36761 WP_001126780.1.36799 WP_001126780.1.36826 WP_001126780.1.36904 WP_001126780.1.3697 WP_001126780.1.37020 WP_001126780.1.37032 WP_001126780.1.37049 WP_001126780.1.37099 WP_001126780.1.37103 WP_001126780.1.37153 WP_001126780.1.37206 WP_001126780.1.37226 WP_001126780.1.3723 WP_001126780.1.37233 WP_001126780.1.37252 WP_001126780.1.37261 WP_001126780.1.37266 WP_001126780.1.37290 WP_001126780.1.37306 WP_001126780.1.37312 WP_001126780.1.37313 WP_001126780.1.37334 WP_001126780.1.37342 WP_001126780.1.37352 WP_001126780.1.37360 WP_001126780.1.37371 WP_001126780.1.37388 WP_001126780.1.37423 WP_001126780.1.37433 WP_001126780.1.37445 WP_001126780.1.37472 WP_001126780.1.37477 WP_001126780.1.37485 WP_001126780.1.37516 WP_001126780.1.37538 WP_001126780.1.37544 WP_001126780.1.37548 WP_001126780.1.37550 WP_001126780.1.37576 WP_001126780.1.37588 WP_001126780.1.37592 WP_001126780.1.37608 WP_001126780.1.37634 WP_001126780.1.37664 WP_001126780.1.37736 WP_001126780.1.37758 WP_001126780.1.37773 WP_001126780.1.37847 WP_001126780.1.37852 WP_001126780.1.37853 WP_001126780.1.3788 WP_001126780.1.37880 WP_001126780.1.37887 WP_001126780.1.37897 WP_001126780.1.37923 WP_001126780.1.37962 WP_001126780.1.37984 WP_001126780.1.37998 WP_001126780.1.38000 WP_001126780.1.38043 WP_001126780.1.38080 WP_001126780.1.38081 WP_001126780.1.38105 WP_001126780.1.3811 WP_001126780.1.38120 WP_001126780.1.3815 WP_001126780.1.38155 WP_001126780.1.38182 WP_001126780.1.38185 WP_001126780.1.38194 WP_001126780.1.38211 WP_001126780.1.3822 WP_001126780.1.38234 WP_001126780.1.38257 WP_001126780.1.38293 WP_001126780.1.38300 WP_001126780.1.38314 WP_001126780.1.38323 WP_001126780.1.38371 WP_001126780.1.38392 WP_001126780.1.38533 WP_001126780.1.38561 WP_001126780.1.38567 WP_001126780.1.38584 WP_001126780.1.38636 WP_001126780.1.38694 WP_001126780.1.38751 WP_001126780.1.38777 WP_001126780.1.38896 WP_001126780.1.38920 WP_001126780.1.38935 WP_001126780.1.38937 WP_001126780.1.38950 WP_001126780.1.38956 WP_001126780.1.3904 WP_001126780.1.39042 WP_001126780.1.3912 WP_001126780.1.39164 WP_001126780.1.39167 WP_001126780.1.39184 WP_001126780.1.39196 WP_001126780.1.39209 WP_001126780.1.39232 WP_001126780.1.39254 WP_001126780.1.39289 WP_001126780.1.39302 WP_001126780.1.39305 WP_001126780.1.39313 WP_001126780.1.39325 WP_001126780.1.39327 WP_001126780.1.39356 WP_001126780.1.39365 WP_001126780.1.39377 WP_001126780.1.39401 WP_001126780.1.39402 WP_001126780.1.39423 WP_001126780.1.39430 WP_001126780.1.39481 WP_001126780.1.39492 WP_001126780.1.39509 WP_001126780.1.39531 WP_001126780.1.3954 WP_001126780.1.39541 WP_001126780.1.39606 WP_001126780.1.39651 WP_001126780.1.39708 WP_001126780.1.39709 WP_001126780.1.39713 WP_001126780.1.39717 WP_001126780.1.39733 WP_001126780.1.39734 WP_001126780.1.39780 WP_001126780.1.39796 WP_001126780.1.3980 WP_001126780.1.39809 WP_001126780.1.39822 WP_001126780.1.39829 WP_001126780.1.39867 WP_001126780.1.39870 WP_001126780.1.39892 WP_001126780.1.39938 WP_001126780.1.39961 WP_001126780.1.39966 WP_001126780.1.39970 WP_001126780.1.39973 WP_001126780.1.39998 WP_001126780.1.40016 WP_001126780.1.40019 WP_001126780.1.40083 WP_001126780.1.40088 WP_001126780.1.40107 WP_001126780.1.40153 WP_001126780.1.40190 WP_001126780.1.40192 WP_001126780.1.4020 WP_001126780.1.40211 WP_001126780.1.40218 WP_001126780.1.40238 WP_001126780.1.40298 WP_001126780.1.40300 WP_001126780.1.40317 WP_001126780.1.40319 WP_001126780.1.40335 WP_001126780.1.40345 WP_001126780.1.40349 WP_001126780.1.40360 WP_001126780.1.40389 WP_001126780.1.40403 WP_001126780.1.40445 WP_001126780.1.40486 WP_001126780.1.4049 WP_001126780.1.40499 WP_001126780.1.40502 WP_001126780.1.40524 WP_001126780.1.40539 WP_001126780.1.40548 WP_001126780.1.40560 WP_001126780.1.40596 WP_001126780.1.40607 WP_001126780.1.40617 WP_001126780.1.40636 WP_001126780.1.40657 WP_001126780.1.40660 WP_001126780.1.40666 WP_001126780.1.40686 WP_001126780.1.40712 WP_001126780.1.40715 WP_001126780.1.40781 WP_001126780.1.40815 WP_001126780.1.4082 WP_001126780.1.40833 WP_001126780.1.40842 WP_001126780.1.40843 WP_001126780.1.40898 WP_001126780.1.40912 WP_001126780.1.40937 WP_001126780.1.40965 WP_001126780.1.41037 WP_001126780.1.41041 WP_001126780.1.41045 WP_001126780.1.41063 WP_001126780.1.41078 WP_001126780.1.41113 WP_001126780.1.41147 WP_001126780.1.41206 WP_001126780.1.4122 WP_001126780.1.41239 WP_001126780.1.4126 WP_001126780.1.41263 WP_001126780.1.41287 WP_001126780.1.41332 WP_001126780.1.41368 WP_001126780.1.41371 WP_001126780.1.41401 WP_001126780.1.41402 WP_001126780.1.41436 WP_001126780.1.41453 WP_001126780.1.41481 WP_001126780.1.41482 WP_001126780.1.41483 WP_001126780.1.41488 WP_001126780.1.41530 WP_001126780.1.41539 WP_001126780.1.41556 WP_001126780.1.41566 WP_001126780.1.41654 WP_001126780.1.41712 WP_001126780.1.4172 WP_001126780.1.41741 WP_001126780.1.41780 WP_001126780.1.41782 WP_001126780.1.41783 WP_001126780.1.41784 WP_001126780.1.41812 WP_001126780.1.41813 WP_001126780.1.41822 WP_001126780.1.41837 WP_001126780.1.41847 WP_001126780.1.41885 WP_001126780.1.4189 WP_001126780.1.41900 WP_001126780.1.41923 WP_001126780.1.4193 WP_001126780.1.41956 WP_001126780.1.41960 WP_001126780.1.41964 WP_001126780.1.41988 WP_001126780.1.41990 WP_001126780.1.42022 WP_001126780.1.42033 WP_001126780.1.42044 WP_001126780.1.42060 WP_001126780.1.42073 WP_001126780.1.4214 WP_001126780.1.42159 WP_001126780.1.42179 WP_001126780.1.42191 WP_001126780.1.42209 WP_001126780.1.42214 WP_001126780.1.42221 WP_001126780.1.42226 WP_001126780.1.42233 WP_001126780.1.42318 WP_001126780.1.42350 WP_001126780.1.42367 WP_001126780.1.42376 WP_001126780.1.42413 WP_001126780.1.42415 WP_001126780.1.4242 WP_001126780.1.42456 WP_001126780.1.42480 WP_001126780.1.42516 WP_001126780.1.42522 WP_001126780.1.42547 WP_001126780.1.42586 WP_001126780.1.42597 WP_001126780.1.42600 WP_001126780.1.42601 WP_001126780.1.42638 WP_001126780.1.42661 WP_001126780.1.42669 WP_001126780.1.42670 WP_001126780.1.42677 WP_001126780.1.42709 WP_001126780.1.42756 WP_001126780.1.42770 WP_001126780.1.42771 WP_001126780.1.42804 WP_001126780.1.42808 WP_001126780.1.4282 WP_001126780.1.42879 WP_001126780.1.42891 WP_001126780.1.4290 WP_001126780.1.42903 WP_001126780.1.42936 WP_001126780.1.42950 WP_001126780.1.42962 WP_001126780.1.42970 WP_001126780.1.42987 WP_001126780.1.42989 WP_001126780.1.42991 WP_001126780.1.43027 WP_001126780.1.4306 WP_001126780.1.43132 WP_001126780.1.43170 WP_001126780.1.43213 WP_001126780.1.43239 WP_001126780.1.43270 WP_001126780.1.43278 WP_001126780.1.4334 WP_001126780.1.43363 WP_001126780.1.43389 WP_001126780.1.43422 WP_001126780.1.43427 WP_001126780.1.4343 WP_001126780.1.43444 WP_001126780.1.43455 WP_001126780.1.43489 WP_001126780.1.4356 WP_001126780.1.43598 WP_001126780.1.43622 WP_001126780.1.43642 WP_001126780.1.43720 WP_001126780.1.43733 WP_001126780.1.43769 WP_001126780.1.43803 WP_001126780.1.43804 WP_001126780.1.43858 WP_001126780.1.43868 WP_001126780.1.43898 WP_001126780.1.43925 WP_001126780.1.43942 WP_001126780.1.43953 WP_001126780.1.440 WP_001126780.1.44040 WP_001126780.1.44051 WP_001126780.1.44075 WP_001126780.1.44096 WP_001126780.1.44100 WP_001126780.1.44115 WP_001126780.1.44130 WP_001126780.1.44162 WP_001126780.1.44166 WP_001126780.1.44211 WP_001126780.1.44238 WP_001126780.1.44263 WP_001126780.1.44273 WP_001126780.1.44292 WP_001126780.1.44327 WP_001126780.1.44354 WP_001126780.1.44365 WP_001126780.1.44394 WP_001126780.1.44447 WP_001126780.1.44460 WP_001126780.1.44570 WP_001126780.1.44587 WP_001126780.1.4459 WP_001126780.1.44608 WP_001126780.1.44610 WP_001126780.1.44622 WP_001126780.1.4463 WP_001126780.1.44642 WP_001126780.1.44668 WP_001126780.1.44717 WP_001126780.1.44724 WP_001126780.1.4473 WP_001126780.1.44756 WP_001126780.1.44759 WP_001126780.1.44784 WP_001126780.1.44800 WP_001126780.1.44836 WP_001126780.1.44841 WP_001126780.1.44843 WP_001126780.1.44849 WP_001126780.1.44854 WP_001126780.1.44855 WP_001126780.1.44857 WP_001126780.1.44923 WP_001126780.1.44960 WP_001126780.1.44961 WP_001126780.1.44970 WP_001126780.1.44975 WP_001126780.1.44977 WP_001126780.1.44980 WP_001126780.1.45025 WP_001126780.1.45116 WP_001126780.1.4516 WP_001126780.1.45190 WP_001126780.1.45208 WP_001126780.1.45246 WP_001126780.1.4530 WP_001126780.1.45301 WP_001126780.1.45313 WP_001126780.1.45329 WP_001126780.1.45359 WP_001126780.1.45405 WP_001126780.1.4549 WP_001126780.1.45525 WP_001126780.1.45536 WP_001126780.1.45581 WP_001126780.1.45595 WP_001126780.1.45600 WP_001126780.1.45627 WP_001126780.1.45664 WP_001126780.1.45676 WP_001126780.1.45718 WP_001126780.1.4574 WP_001126780.1.45741 WP_001126780.1.45752 WP_001126780.1.4576 WP_001126780.1.45789 WP_001126780.1.45793 WP_001126780.1.45801 WP_001126780.1.4583 WP_001126780.1.45865 WP_001126780.1.45891 WP_001126780.1.45921 WP_001126780.1.4593 WP_001126780.1.45930 WP_001126780.1.45933 WP_001126780.1.45945 WP_001126780.1.45968 WP_001126780.1.45990 WP_001126780.1.46016 WP_001126780.1.46026 WP_001126780.1.46027 WP_001126780.1.46048 WP_001126780.1.46097 WP_001126780.1.4610 WP_001126780.1.46164 WP_001126780.1.46186 WP_001126780.1.46197 WP_001126780.1.46213 WP_001126780.1.46217 WP_001126780.1.46263 WP_001126780.1.46291 WP_001126780.1.46301 WP_001126780.1.46325 WP_001126780.1.46378 WP_001126780.1.46379 WP_001126780.1.46438 WP_001126780.1.46441 WP_001126780.1.46487 WP_001126780.1.46526 WP_001126780.1.46552 WP_001126780.1.4657 WP_001126780.1.46573 WP_001126780.1.46582 WP_001126780.1.46594 WP_001126780.1.46743 WP_001126780.1.46795 WP_001126780.1.46798 WP_001126780.1.46802 WP_001126780.1.46806 WP_001126780.1.46820 WP_001126780.1.46821 WP_001126780.1.46833 WP_001126780.1.46882 WP_001126780.1.46909 WP_001126780.1.46912 WP_001126780.1.46932 WP_001126780.1.46991 WP_001126780.1.46994 WP_001126780.1.46999 WP_001126780.1.47024 WP_001126780.1.47038 WP_001126780.1.47039 WP_001126780.1.47047 WP_001126780.1.47048 WP_001126780.1.47054 WP_001126780.1.47063 WP_001126780.1.47124 WP_001126780.1.47186 WP_001126780.1.47189 WP_001126780.1.47197 WP_001126780.1.47224 WP_001126780.1.47235 WP_001126780.1.47246 WP_001126780.1.47247 WP_001126780.1.4725 WP_001126780.1.47307 WP_001126780.1.47319 WP_001126780.1.47322 WP_001126780.1.47344 WP_001126780.1.47349 WP_001126780.1.47363 WP_001126780.1.47366 WP_001126780.1.47370 WP_001126780.1.47386 WP_001126780.1.47398 WP_001126780.1.47414 WP_001126780.1.4743 WP_001126780.1.47454 WP_001126780.1.47477 WP_001126780.1.47488 WP_001126780.1.47496 WP_001126780.1.47498 WP_001126780.1.47500 WP_001126780.1.47546 WP_001126780.1.47599 WP_001126780.1.47634 WP_001126780.1.47646 WP_001126780.1.47654 WP_001126780.1.47709 WP_001126780.1.4772 WP_001126780.1.47722 WP_001126780.1.47734 WP_001126780.1.47764 WP_001126780.1.47765 WP_001126780.1.47770 WP_001126780.1.47791 WP_001126780.1.4783 WP_001126780.1.47935 WP_001126780.1.4796 WP_001126780.1.47962 WP_001126780.1.47976 WP_001126780.1.48000 WP_001126780.1.48018 WP_001126780.1.48029 WP_001126780.1.48040 WP_001126780.1.48051 WP_001126780.1.48080 WP_001126780.1.48096 WP_001126780.1.4811 WP_001126780.1.48121 WP_001126780.1.48194 WP_001126780.1.48203 WP_001126780.1.48216 WP_001126780.1.48222 WP_001126780.1.4826 WP_001126780.1.48265 WP_001126780.1.48290 WP_001126780.1.48317 WP_001126780.1.48353 WP_001126780.1.48355 WP_001126780.1.48421 WP_001126780.1.48431 WP_001126780.1.48469 WP_001126780.1.48477 WP_001126780.1.48483 WP_001126780.1.48522 WP_001126780.1.486 WP_001126780.1.48615 WP_001126780.1.48620 WP_001126780.1.48626 WP_001126780.1.48629 WP_001126780.1.48678 WP_001126780.1.4871 WP_001126780.1.4876 WP_001126780.1.48808 WP_001126780.1.48827 WP_001126780.1.48847 WP_001126780.1.48860 WP_001126780.1.48901 WP_001126780.1.48902 WP_001126780.1.48910 WP_001126780.1.4892 WP_001126780.1.48921 WP_001126780.1.48926 WP_001126780.1.48928 WP_001126780.1.48953 WP_001126780.1.48974 WP_001126780.1.49001 WP_001126780.1.49009 WP_001126780.1.49061 WP_001126780.1.49076 WP_001126780.1.49170 WP_001126780.1.49179 WP_001126780.1.49236 WP_001126780.1.49243 WP_001126780.1.49275 WP_001126780.1.49342 WP_001126780.1.49347 WP_001126780.1.49412 WP_001126780.1.49446 WP_001126780.1.49481 WP_001126780.1.49483 WP_001126780.1.4949 WP_001126780.1.49521 WP_001126780.1.49522 WP_001126780.1.49531 WP_001126780.1.49537 WP_001126780.1.49546 WP_001126780.1.49558 WP_001126780.1.49594 WP_001126780.1.49599 WP_001126780.1.49615 WP_001126780.1.49625 WP_001126780.1.49645 WP_001126780.1.49661 WP_001126780.1.49662 WP_001126780.1.49675 WP_001126780.1.49722 WP_001126780.1.49733 WP_001126780.1.49740 WP_001126780.1.49747 WP_001126780.1.49768 WP_001126780.1.49783 WP_001126780.1.49788 WP_001126780.1.49794 WP_001126780.1.49820 WP_001126780.1.4985 WP_001126780.1.49861 WP_001126780.1.49879 WP_001126780.1.49883 WP_001126780.1.49884 WP_001126780.1.49900 WP_001126780.1.49941 WP_001126780.1.49972 WP_001126780.1.50006 WP_001126780.1.50008 WP_001126780.1.50056 WP_001126780.1.50058 WP_001126780.1.50078 WP_001126780.1.50113 WP_001126780.1.50146 WP_001126780.1.5017 WP_001126780.1.50179 WP_001126780.1.50207 WP_001126780.1.50228 WP_001126780.1.50262 WP_001126780.1.50266 WP_001126780.1.50270 WP_001126780.1.50278 WP_001126780.1.50304 WP_001126780.1.50353 WP_001126780.1.50412 WP_001126780.1.50427 WP_001126780.1.50452 WP_001126780.1.5056 WP_001126780.1.50564 WP_001126780.1.50579 WP_001126780.1.50585 WP_001126780.1.50616 WP_001126780.1.50627 WP_001126780.1.50690 WP_001126780.1.50717 WP_001126780.1.50725 WP_001126780.1.50887 WP_001126780.1.50925 WP_001126780.1.50947 WP_001126780.1.5095 WP_001126780.1.50969 WP_001126780.1.50988 WP_001126780.1.50990 WP_001126780.1.50996 WP_001126780.1.51013 WP_001126780.1.51027 WP_001126780.1.51042 WP_001126780.1.511 WP_001126780.1.51109 WP_001126780.1.51170 WP_001126780.1.51172 WP_001126780.1.51180 WP_001126780.1.51190 WP_001126780.1.51203 WP_001126780.1.51211 WP_001126780.1.5124 WP_001126780.1.51248 WP_001126780.1.51253 WP_001126780.1.51255 WP_001126780.1.5128 WP_001126780.1.51300 WP_001126780.1.51380 WP_001126780.1.51392 WP_001126780.1.51405 WP_001126780.1.51425 WP_001126780.1.51426 WP_001126780.1.51427 WP_001126780.1.51430 WP_001126780.1.5146 WP_001126780.1.51490 WP_001126780.1.51495 WP_001126780.1.5153 WP_001126780.1.51539 WP_001126780.1.51548 WP_001126780.1.51552 WP_001126780.1.5157 WP_001126780.1.51580 WP_001126780.1.51596 WP_001126780.1.51607 WP_001126780.1.51629 WP_001126780.1.51690 WP_001126780.1.5172 WP_001126780.1.51757 WP_001126780.1.51784 WP_001126780.1.518 WP_001126780.1.51804 WP_001126780.1.51839 WP_001126780.1.51873 WP_001126780.1.51881 WP_001126780.1.51896 WP_001126780.1.51899 WP_001126780.1.51944 WP_001126780.1.51949 WP_001126780.1.51968 WP_001126780.1.51985 WP_001126780.1.51988 WP_001126780.1.5199 WP_001126780.1.52002 WP_001126780.1.52020 WP_001126780.1.52048 WP_001126780.1.52062 WP_001126780.1.52076 WP_001126780.1.52085 WP_001126780.1.52098 WP_001126780.1.52127 WP_001126780.1.52135 WP_001126780.1.52171 WP_001126780.1.52186 WP_001126780.1.52200 WP_001126780.1.52211 WP_001126780.1.52214 WP_001126780.1.52243 WP_001126780.1.52258 WP_001126780.1.52270 WP_001126780.1.52271 WP_001126780.1.52305 WP_001126780.1.52333 WP_001126780.1.52363 WP_001126780.1.5239 WP_001126780.1.52419 WP_001126780.1.52421 WP_001126780.1.52492 WP_001126780.1.52542 WP_001126780.1.52544 WP_001126780.1.52558 WP_001126780.1.52568 WP_001126780.1.52631 WP_001126780.1.52662 WP_001126780.1.52710 WP_001126780.1.5272 WP_001126780.1.52771 WP_001126780.1.52774 WP_001126780.1.52781 WP_001126780.1.52844 WP_001126780.1.5285 WP_001126780.1.52852 WP_001126780.1.52855 WP_001126780.1.52881 WP_001126780.1.52895 WP_001126780.1.52908 WP_001126780.1.52913 WP_001126780.1.52945 WP_001126780.1.52962 WP_001126780.1.53012 WP_001126780.1.53020 WP_001126780.1.53021 WP_001126780.1.53065 WP_001126780.1.53110 WP_001126780.1.53155 WP_001126780.1.53162 WP_001126780.1.5322 WP_001126780.1.53238 WP_001126780.1.53242 WP_001126780.1.53244 WP_001126780.1.53364 WP_001126780.1.53377 WP_001126780.1.53410 WP_001126780.1.53415 WP_001126780.1.53428 WP_001126780.1.53482 WP_001126780.1.53545 WP_001126780.1.53556 WP_001126780.1.53587 WP_001126780.1.53590 WP_001126780.1.5362 WP_001126780.1.53642 WP_001126780.1.53649 WP_001126780.1.53687 WP_001126780.1.53690 WP_001126780.1.53693 WP_001126780.1.53769 WP_001126780.1.53809 WP_001126780.1.53841 WP_001126780.1.53863 WP_001126780.1.53884 WP_001126780.1.5391 WP_001126780.1.53931 WP_001126780.1.53940 WP_001126780.1.53972 WP_001126780.1.53991 WP_001126780.1.53994 WP_001126780.1.54002 WP_001126780.1.54028 WP_001126780.1.54051 WP_001126780.1.54072 WP_001126780.1.54095 WP_001126780.1.54102 WP_001126780.1.54169 WP_001126780.1.54185 WP_001126780.1.54188 WP_001126780.1.54208 WP_001126780.1.54263 WP_001126780.1.54313 WP_001126780.1.5434 WP_001126780.1.54344 WP_001126780.1.54359 WP_001126780.1.54388 WP_001126780.1.54394 WP_001126780.1.54417 WP_001126780.1.54418 WP_001126780.1.54429 WP_001126780.1.54439 WP_001126780.1.54476 WP_001126780.1.54507 WP_001126780.1.54524 WP_001126780.1.54534 WP_001126780.1.54590 WP_001126780.1.54591 WP_001126780.1.5460 WP_001126780.1.54602 WP_001126780.1.54605 WP_001126780.1.54617 WP_001126780.1.54620 WP_001126780.1.54638 WP_001126780.1.54688 WP_001126780.1.54695 WP_001126780.1.5470 WP_001126780.1.54708 WP_001126780.1.54725 WP_001126780.1.54729 WP_001126780.1.54754 WP_001126780.1.5478 WP_001126780.1.5479 WP_001126780.1.54829 WP_001126780.1.54875 WP_001126780.1.54927 WP_001126780.1.54940 WP_001126780.1.54981 WP_001126780.1.54991 WP_001126780.1.54993 WP_001126780.1.55003 WP_001126780.1.55041 WP_001126780.1.55115 WP_001126780.1.55134 WP_001126780.1.55144 WP_001126780.1.55149 WP_001126780.1.55151 WP_001126780.1.55179 WP_001126780.1.55197 WP_001126780.1.55203 WP_001126780.1.55222 WP_001126780.1.55226 WP_001126780.1.55273 WP_001126780.1.55291 WP_001126780.1.55338 WP_001126780.1.55359 WP_001126780.1.55381 WP_001126780.1.55420 WP_001126780.1.5546 WP_001126780.1.55466 WP_001126780.1.55472 WP_001126780.1.55507 WP_001126780.1.55529 WP_001126780.1.55550 WP_001126780.1.55552 WP_001126780.1.55556 WP_001126780.1.55563 WP_001126780.1.55571 WP_001126780.1.55574 WP_001126780.1.55608 WP_001126780.1.55629 WP_001126780.1.55676 WP_001126780.1.55731 WP_001126780.1.55744 WP_001126780.1.55790 WP_001126780.1.55791 WP_001126780.1.55808 WP_001126780.1.55825 WP_001126780.1.55868 WP_001126780.1.55888 WP_001126780.1.55936 WP_001126780.1.55981 WP_001126780.1.55990 WP_001126780.1.56033 WP_001126780.1.56040 WP_001126780.1.56047 WP_001126780.1.561 WP_001126780.1.56122 WP_001126780.1.56139 WP_001126780.1.5614 WP_001126780.1.56142 WP_001126780.1.56164 WP_001126780.1.56169 WP_001126780.1.56177 WP_001126780.1.56197 WP_001126780.1.56216 WP_001126780.1.56231 WP_001126780.1.56278 WP_001126780.1.56285 WP_001126780.1.5632 WP_001126780.1.56338 WP_001126780.1.56390 WP_001126780.1.56399 WP_001126780.1.56402 WP_001126780.1.56436 WP_001126780.1.56439 WP_001126780.1.56457 WP_001126780.1.56469 WP_001126780.1.56513 WP_001126780.1.56523 WP_001126780.1.56586 WP_001126780.1.56650 WP_001126780.1.56662 WP_001126780.1.56665 WP_001126780.1.56704 WP_001126780.1.56714 WP_001126780.1.56721 WP_001126780.1.56789 WP_001126780.1.56799 WP_001126780.1.56821 WP_001126780.1.56846 WP_001126780.1.56871 WP_001126780.1.56882 WP_001126780.1.56933 WP_001126780.1.56934 WP_001126780.1.56936 WP_001126780.1.56978 WP_001126780.1.56980 WP_001126780.1.57011 WP_001126780.1.57045 WP_001126780.1.57072 WP_001126780.1.57079 WP_001126780.1.57086 WP_001126780.1.57159 WP_001126780.1.57181 WP_001126780.1.57202 WP_001126780.1.57213 WP_001126780.1.57222 WP_001126780.1.57278 WP_001126780.1.57281 WP_001126780.1.57401 WP_001126780.1.57403 WP_001126780.1.57410 WP_001126780.1.57414 WP_001126780.1.5742 WP_001126780.1.57432 WP_001126780.1.57438 WP_001126780.1.57451 WP_001126780.1.5748 WP_001126780.1.57487 WP_001126780.1.57492 WP_001126780.1.57517 WP_001126780.1.57538 WP_001126780.1.57539 WP_001126780.1.5755 WP_001126780.1.57550 WP_001126780.1.57558 WP_001126780.1.57608 WP_001126780.1.57659 WP_001126780.1.57669 WP_001126780.1.57719 WP_001126780.1.57738 WP_001126780.1.57832 WP_001126780.1.57846 WP_001126780.1.57854 WP_001126780.1.5786 WP_001126780.1.5787 WP_001126780.1.57920 WP_001126780.1.57982 WP_001126780.1.58001 WP_001126780.1.58009 WP_001126780.1.58038 WP_001126780.1.58045 WP_001126780.1.58080 WP_001126780.1.58092 WP_001126780.1.58094 WP_001126780.1.58097 WP_001126780.1.58107 WP_001126780.1.58163 WP_001126780.1.58206 WP_001126780.1.58232 WP_001126780.1.58233 WP_001126780.1.58248 WP_001126780.1.58289 WP_001126780.1.58292 WP_001126780.1.58336 WP_001126780.1.58340 WP_001126780.1.58345 WP_001126780.1.58401 WP_001126780.1.58408 WP_001126780.1.58414 WP_001126780.1.5842 WP_001126780.1.58420 WP_001126780.1.58424 WP_001126780.1.58429 WP_001126780.1.58440 WP_001126780.1.58449 WP_001126780.1.58459 WP_001126780.1.58475 WP_001126780.1.58493 WP_001126780.1.585 WP_001126780.1.58528 WP_001126780.1.58547 WP_001126780.1.58552 WP_001126780.1.58609 WP_001126780.1.58617 WP_001126780.1.58622 WP_001126780.1.58657 WP_001126780.1.58692 WP_001126780.1.58705 WP_001126780.1.58867 WP_001126780.1.58901 WP_001126780.1.58940 WP_001126780.1.58951 WP_001126780.1.58976 WP_001126780.1.59024 WP_001126780.1.59035 WP_001126780.1.59055 WP_001126780.1.5906 WP_001126780.1.59073 WP_001126780.1.59174 WP_001126780.1.59199 WP_001126780.1.5927 WP_001126780.1.59291 WP_001126780.1.59292 WP_001126780.1.59293 WP_001126780.1.59306 WP_001126780.1.59407 WP_001126780.1.59413 WP_001126780.1.5942 WP_001126780.1.59426 WP_001126780.1.59483 WP_001126780.1.59513 WP_001126780.1.59533 WP_001126780.1.59553 WP_001126780.1.59572 WP_001126780.1.59577 WP_001126780.1.59579 WP_001126780.1.59611 WP_001126780.1.59613 WP_001126780.1.59615 WP_001126780.1.5963 WP_001126780.1.5965 WP_001126780.1.59660 WP_001126780.1.59699 WP_001126780.1.59714 WP_001126780.1.59730 WP_001126780.1.59737 WP_001126780.1.59745 WP_001126780.1.59756 WP_001126780.1.59781 WP_001126780.1.59788 WP_001126780.1.59793 WP_001126780.1.59815 WP_001126780.1.59853 WP_001126780.1.59858 WP_001126780.1.59894 WP_001126780.1.59900 WP_001126780.1.59912 WP_001126780.1.59932 WP_001126780.1.59970 WP_001126780.1.59980 WP_001126780.1.59981 WP_001126780.1.59998 WP_001126780.1.6002 WP_001126780.1.60023 WP_001126780.1.60031 WP_001126780.1.60095 WP_001126780.1.60110 WP_001126780.1.60133 WP_001126780.1.60151 WP_001126780.1.60225 WP_001126780.1.60235 WP_001126780.1.60343 WP_001126780.1.60350 WP_001126780.1.60373 WP_001126780.1.60436 WP_001126780.1.60457 WP_001126780.1.60498 WP_001126780.1.60544 WP_001126780.1.60550 WP_001126780.1.60555 WP_001126780.1.60576 WP_001126780.1.60591 WP_001126780.1.6061 WP_001126780.1.60630 WP_001126780.1.60654 WP_001126780.1.6066 WP_001126780.1.60698 WP_001126780.1.60717 WP_001126780.1.60832 WP_001126780.1.60895 WP_001126780.1.60901 WP_001126780.1.61008 WP_001126780.1.61046 WP_001126780.1.61058 WP_001126780.1.6106 WP_001126780.1.61096 WP_001126780.1.61097 WP_001126780.1.61121 WP_001126780.1.61170 WP_001126780.1.61174 WP_001126780.1.61175 WP_001126780.1.61181 WP_001126780.1.61183 WP_001126780.1.61241 WP_001126780.1.61245 WP_001126780.1.61284 WP_001126780.1.61292 WP_001126780.1.613 WP_001126780.1.6138 WP_001126780.1.61398 WP_001126780.1.61442 WP_001126780.1.61445 WP_001126780.1.61480 WP_001126780.1.615 WP_001126780.1.61505 WP_001126780.1.61551 WP_001126780.1.61617 WP_001126780.1.61636 WP_001126780.1.61663 WP_001126780.1.61739 WP_001126780.1.61779 WP_001126780.1.61789 WP_001126780.1.61806 WP_001126780.1.61822 WP_001126780.1.61835 WP_001126780.1.61939 WP_001126780.1.61949 WP_001126780.1.61955 WP_001126780.1.62038 WP_001126780.1.62041 WP_001126780.1.62043 WP_001126780.1.62091 WP_001126780.1.62099 WP_001126780.1.62102 WP_001126780.1.6212 WP_001126780.1.62157 WP_001126780.1.62207 WP_001126780.1.62236 WP_001126780.1.62262 WP_001126780.1.62290 WP_001126780.1.62296 WP_001126780.1.62337 WP_001126780.1.62358 WP_001126780.1.62447 WP_001126780.1.62454 WP_001126780.1.62460 WP_001126780.1.62481 WP_001126780.1.62487 WP_001126780.1.62503 WP_001126780.1.62555 WP_001126780.1.62586 WP_001126780.1.62612 WP_001126780.1.62642 WP_001126780.1.62646 WP_001126780.1.62668 WP_001126780.1.62681 WP_001126780.1.62750 WP_001126780.1.62780 WP_001126780.1.62784 WP_001126780.1.62788 WP_001126780.1.62812 WP_001126780.1.62818 WP_001126780.1.6282 WP_001126780.1.62840 WP_001126780.1.62850 WP_001126780.1.62866 WP_001126780.1.62885 WP_001126780.1.62914 WP_001126780.1.62919 WP_001126780.1.6293 WP_001126780.1.62951 WP_001126780.1.62959 WP_001126780.1.62973 WP_001126780.1.62989 WP_001126780.1.63078 WP_001126780.1.63113 WP_001126780.1.63167 WP_001126780.1.63177 WP_001126780.1.6323 WP_001126780.1.63271 WP_001126780.1.63285 WP_001126780.1.63310 WP_001126780.1.6337 WP_001126780.1.63370 WP_001126780.1.63374 WP_001126780.1.63393 WP_001126780.1.63419 WP_001126780.1.63453 WP_001126780.1.63465 WP_001126780.1.63470 WP_001126780.1.6348 WP_001126780.1.63484 WP_001126780.1.63491 WP_001126780.1.63496 WP_001126780.1.63536 WP_001126780.1.63721 WP_001126780.1.63810 WP_001126780.1.63814 WP_001126780.1.63856 WP_001126780.1.64008 WP_001126780.1.64030 WP_001126780.1.64040 WP_001126780.1.64045 WP_001126780.1.64053 WP_001126780.1.64080 WP_001126780.1.64110 WP_001126780.1.64138 WP_001126780.1.64150 WP_001126780.1.64165 WP_001126780.1.64180 WP_001126780.1.64190 WP_001126780.1.64285 WP_001126780.1.643 WP_001126780.1.64312 WP_001126780.1.64321 WP_001126780.1.64330 WP_001126780.1.64353 WP_001126780.1.64380 WP_001126780.1.64391 WP_001126780.1.64417 WP_001126780.1.64438 WP_001126780.1.64448 WP_001126780.1.64458 WP_001126780.1.6446 WP_001126780.1.64520 WP_001126780.1.64528 WP_001126780.1.64547 WP_001126780.1.64657 WP_001126780.1.64670 WP_001126780.1.64693 WP_001126780.1.64695 WP_001126780.1.64707 WP_001126780.1.64712 WP_001126780.1.64784 WP_001126780.1.64789 WP_001126780.1.64840 WP_001126780.1.64875 WP_001126780.1.64881 WP_001126780.1.64912 WP_001126780.1.64926 WP_001126780.1.64970 WP_001126780.1.6499 WP_001126780.1.64990 WP_001126780.1.6500 WP_001126780.1.65061 WP_001126780.1.65097 WP_001126780.1.65104 WP_001126780.1.65114 WP_001126780.1.65116 WP_001126780.1.65122 WP_001126780.1.65179 WP_001126780.1.65240 WP_001126780.1.65256 WP_001126780.1.6527 WP_001126780.1.65271 WP_001126780.1.65286 WP_001126780.1.65305 WP_001126780.1.65306 WP_001126780.1.65355 WP_001126780.1.65364 WP_001126780.1.65405 WP_001126780.1.65408 WP_001126780.1.65413 WP_001126780.1.65415 WP_001126780.1.65456 WP_001126780.1.65531 WP_001126780.1.65565 WP_001126780.1.65571 WP_001126780.1.65581 WP_001126780.1.65596 WP_001126780.1.65606 WP_001126780.1.6563 WP_001126780.1.65708 WP_001126780.1.65749 WP_001126780.1.6576 WP_001126780.1.65762 WP_001126780.1.65834 WP_001126780.1.65912 WP_001126780.1.65957 WP_001126780.1.65961 WP_001126780.1.66001 WP_001126780.1.66017 WP_001126780.1.66022 WP_001126780.1.66044 WP_001126780.1.66050 WP_001126780.1.66071 WP_001126780.1.6609 WP_001126780.1.66094 WP_001126780.1.66104 WP_001126780.1.66105 WP_001126780.1.66121 WP_001126780.1.66127 WP_001126780.1.66161 WP_001126780.1.6618 WP_001126780.1.66181 WP_001126780.1.66187 WP_001126780.1.66197 WP_001126780.1.66255 WP_001126780.1.66280 WP_001126780.1.66290 WP_001126780.1.66295 WP_001126780.1.66327 WP_001126780.1.66376 WP_001126780.1.66387 WP_001126780.1.66389 WP_001126780.1.66392 WP_001126780.1.66395 WP_001126780.1.66412 WP_001126780.1.66421 WP_001126780.1.66523 WP_001126780.1.6654 WP_001126780.1.66550 WP_001126780.1.66559 WP_001126780.1.66579 WP_001126780.1.66624 WP_001126780.1.6665 WP_001126780.1.6666 WP_001126780.1.66667 WP_001126780.1.66668 WP_001126780.1.66700 WP_001126780.1.66706 WP_001126780.1.66708 WP_001126780.1.66719 WP_001126780.1.66727 WP_001126780.1.66751 WP_001126780.1.66758 WP_001126780.1.66787 WP_001126780.1.66796 WP_001126780.1.6698 WP_001126780.1.66984 WP_001126780.1.67021 WP_001126780.1.67022 WP_001126780.1.67026 WP_001126780.1.67029 WP_001126780.1.67047 WP_001126780.1.67055 WP_001126780.1.67116 WP_001126780.1.67132 WP_001126780.1.67153 WP_001126780.1.67164 WP_001126780.1.67174 WP_001126780.1.67200 WP_001126780.1.67258 WP_001126780.1.67284 WP_001126780.1.67373 WP_001126780.1.67415 WP_001126780.1.67427 WP_001126780.1.67451 WP_001126780.1.67454 WP_001126780.1.67464 WP_001126780.1.67468 WP_001126780.1.67495 WP_001126780.1.67522 WP_001126780.1.67538 WP_001126780.1.67553 WP_001126780.1.67581 WP_001126780.1.67590 WP_001126780.1.67606 WP_001126780.1.67663 WP_001126780.1.67669 WP_001126780.1.67681 WP_001126780.1.67685 WP_001126780.1.67690 WP_001126780.1.67701 WP_001126780.1.67724 WP_001126780.1.67737 WP_001126780.1.67758 WP_001126780.1.67760 WP_001126780.1.67786 WP_001126780.1.67787 WP_001126780.1.67788 WP_001126780.1.678 WP_001126780.1.67810 WP_001126780.1.67853 WP_001126780.1.67891 WP_001126780.1.67894 WP_001126780.1.67975 WP_001126780.1.67992 WP_001126780.1.68008 WP_001126780.1.68012 WP_001126780.1.68025 WP_001126780.1.6803 WP_001126780.1.68039 WP_001126780.1.68052 WP_001126780.1.68058 WP_001126780.1.68059 WP_001126780.1.68079 WP_001126780.1.6810 WP_001126780.1.6814 WP_001126780.1.68157 WP_001126780.1.68170 WP_001126780.1.68175 WP_001126780.1.68177 WP_001126780.1.68215 WP_001126780.1.68231 WP_001126780.1.68241 WP_001126780.1.68255 WP_001126780.1.68279 WP_001126780.1.68292 WP_001126780.1.68341 WP_001126780.1.68347 WP_001126780.1.68362 WP_001126780.1.68372 WP_001126780.1.68395 WP_001126780.1.68396 WP_001126780.1.68441 WP_001126780.1.68442 WP_001126780.1.68524 WP_001126780.1.68566 WP_001126780.1.68572 WP_001126780.1.6859 WP_001126780.1.68632 WP_001126780.1.68673 WP_001126780.1.68678 WP_001126780.1.68697 WP_001126780.1.68711 WP_001126780.1.68735 WP_001126780.1.68750 WP_001126780.1.6877 WP_001126780.1.68793 WP_001126780.1.68795 WP_001126780.1.68797 WP_001126780.1.68838 WP_001126780.1.68847 WP_001126780.1.68877 WP_001126780.1.68911 WP_001126780.1.68915 WP_001126780.1.68942 WP_001126780.1.68952 WP_001126780.1.68989 WP_001126780.1.68995 WP_001126780.1.69098 WP_001126780.1.69144 WP_001126780.1.69158 WP_001126780.1.6916 WP_001126780.1.69160 WP_001126780.1.6923 WP_001126780.1.69261 WP_001126780.1.69303 WP_001126780.1.69305 WP_001126780.1.69327 WP_001126780.1.69341 WP_001126780.1.69390 WP_001126780.1.694 WP_001126780.1.69438 WP_001126780.1.6945 WP_001126780.1.69450 WP_001126780.1.69472 WP_001126780.1.69473 WP_001126780.1.69502 WP_001126780.1.69551 WP_001126780.1.69569 WP_001126780.1.69583 WP_001126780.1.69593 WP_001126780.1.69605 WP_001126780.1.69643 WP_001126780.1.69646 WP_001126780.1.69655 WP_001126780.1.69689 WP_001126780.1.697 WP_001126780.1.69716 WP_001126780.1.69735 WP_001126780.1.69803 WP_001126780.1.69831 WP_001126780.1.69832 WP_001126780.1.69872 WP_001126780.1.6993 WP_001126780.1.69963 WP_001126780.1.69999 WP_001126780.1.7001 WP_001126780.1.70063 WP_001126780.1.701 WP_001126780.1.7013 WP_001126780.1.7015 WP_001126780.1.70200 WP_001126780.1.70230 WP_001126780.1.70300 WP_001126780.1.70357 WP_001126780.1.70386 WP_001126780.1.70408 WP_001126780.1.70414 WP_001126780.1.7050 WP_001126780.1.70563 WP_001126780.1.70578 WP_001126780.1.70582 WP_001126780.1.70592 WP_001126780.1.70619 WP_001126780.1.70655 WP_001126780.1.70686 WP_001126780.1.70694 WP_001126780.1.70705 WP_001126780.1.70745 WP_001126780.1.70748 WP_001126780.1.70767 WP_001126780.1.70794 WP_001126780.1.70880 WP_001126780.1.70896 WP_001126780.1.7090 WP_001126780.1.70952 WP_001126780.1.70967 WP_001126780.1.7102 WP_001126780.1.71024 WP_001126780.1.71062 WP_001126780.1.71109 WP_001126780.1.71139 WP_001126780.1.71147 WP_001126780.1.71162 WP_001126780.1.71183 WP_001126780.1.7121 WP_001126780.1.71221 WP_001126780.1.71229 WP_001126780.1.71285 WP_001126780.1.71287 WP_001126780.1.71294 WP_001126780.1.71311 WP_001126780.1.71312 WP_001126780.1.71315 WP_001126780.1.71339 WP_001126780.1.71397 WP_001126780.1.71405 WP_001126780.1.71480 WP_001126780.1.71522 WP_001126780.1.71533 WP_001126780.1.71537 WP_001126780.1.71538 WP_001126780.1.71540 WP_001126780.1.71562 WP_001126780.1.71563 WP_001126780.1.71607 WP_001126780.1.71632 WP_001126780.1.71680 WP_001126780.1.71690 WP_001126780.1.71695 WP_001126780.1.71732 WP_001126780.1.71767 WP_001126780.1.71783 WP_001126780.1.71830 WP_001126780.1.71837 WP_001126780.1.71855 WP_001126780.1.71856 WP_001126780.1.71912 WP_001126780.1.71938 WP_001126780.1.71944 WP_001126780.1.71967 WP_001126780.1.71972 WP_001126780.1.71975 WP_001126780.1.71987 WP_001126780.1.71993 WP_001126780.1.72021 WP_001126780.1.72028 WP_001126780.1.72048 WP_001126780.1.7205 WP_001126780.1.72066 WP_001126780.1.72090 WP_001126780.1.72098 WP_001126780.1.72117 WP_001126780.1.72125 WP_001126780.1.72141 WP_001126780.1.72153 WP_001126780.1.72157 WP_001126780.1.72162 WP_001126780.1.72184 WP_001126780.1.72186 WP_001126780.1.72212 WP_001126780.1.72237 WP_001126780.1.7225 WP_001126780.1.72258 WP_001126780.1.72290 WP_001126780.1.723 WP_001126780.1.72316 WP_001126780.1.72337 WP_001126780.1.72352 WP_001126780.1.72359 WP_001126780.1.72388 WP_001126780.1.72397 WP_001126780.1.72425 WP_001126780.1.72431 WP_001126780.1.72436 WP_001126780.1.72469 WP_001126780.1.72485 WP_001126780.1.72507 WP_001126780.1.72511 WP_001126780.1.72521 WP_001126780.1.72537 WP_001126780.1.72544 WP_001126780.1.72551 WP_001126780.1.72582 WP_001126780.1.72588 WP_001126780.1.72596 WP_001126780.1.72599 WP_001126780.1.72606 WP_001126780.1.72616 WP_001126780.1.72643 WP_001126780.1.72652 WP_001126780.1.72700 WP_001126780.1.72706 WP_001126780.1.72745 WP_001126780.1.72751 WP_001126780.1.72758 WP_001126780.1.7281 WP_001126780.1.72860 WP_001126780.1.72869 WP_001126780.1.72910 WP_001126780.1.72947 WP_001126780.1.72950 WP_001126780.1.72962 WP_001126780.1.73000 WP_001126780.1.73010 WP_001126780.1.73039 WP_001126780.1.73072 WP_001126780.1.73085 WP_001126780.1.7309 WP_001126780.1.73094 WP_001126780.1.73215 WP_001126780.1.73217 WP_001126780.1.73230 WP_001126780.1.73239 WP_001126780.1.73243 WP_001126780.1.73257 WP_001126780.1.73259 WP_001126780.1.73291 WP_001126780.1.73292 WP_001126780.1.73295 WP_001126780.1.73333 WP_001126780.1.73344 WP_001126780.1.73385 WP_001126780.1.73428 WP_001126780.1.73430 WP_001126780.1.7345 WP_001126780.1.73468 WP_001126780.1.73486 WP_001126780.1.7349 WP_001126780.1.73524 WP_001126780.1.73565 WP_001126780.1.73572 WP_001126780.1.73604 WP_001126780.1.73717 WP_001126780.1.73748 WP_001126780.1.73783 WP_001126780.1.73807 WP_001126780.1.73835 WP_001126780.1.73844 WP_001126780.1.73859 WP_001126780.1.73942 WP_001126780.1.74032 WP_001126780.1.74041 WP_001126780.1.74046 WP_001126780.1.74051 WP_001126780.1.7407 WP_001126780.1.74123 WP_001126780.1.7413 WP_001126780.1.74156 WP_001126780.1.74184 WP_001126780.1.7425 WP_001126780.1.74267 WP_001126780.1.74309 WP_001126780.1.74365 WP_001126780.1.744 WP_001126780.1.74426 WP_001126780.1.74445 WP_001126780.1.74491 WP_001126780.1.74501 WP_001126780.1.74513 WP_001126780.1.74528 WP_001126780.1.74532 WP_001126780.1.74549 WP_001126780.1.7461 WP_001126780.1.74623 WP_001126780.1.74624 WP_001126780.1.74631 WP_001126780.1.74652 WP_001126780.1.74682 WP_001126780.1.74688 WP_001126780.1.74689 WP_001126780.1.74691 WP_001126780.1.74713 WP_001126780.1.7475 WP_001126780.1.74765 WP_001126780.1.74767 WP_001126780.1.74811 WP_001126780.1.74844 WP_001126780.1.74852 WP_001126780.1.74895 WP_001126780.1.74915 WP_001126780.1.74962 WP_001126780.1.74998 WP_001126780.1.75050 WP_001126780.1.75087 WP_001126780.1.75100 WP_001126780.1.75112 WP_001126780.1.75118 WP_001126780.1.75139 WP_001126780.1.7516 WP_001126780.1.75181 WP_001126780.1.75209 WP_001126780.1.75228 WP_001126780.1.75243 WP_001126780.1.75272 WP_001126780.1.75367 WP_001126780.1.75419 WP_001126780.1.75465 WP_001126780.1.75491 WP_001126780.1.75529 WP_001126780.1.75557 WP_001126780.1.75612 WP_001126780.1.75629 WP_001126780.1.75644 WP_001126780.1.75653 WP_001126780.1.75672 WP_001126780.1.75679 WP_001126780.1.75699 WP_001126780.1.75758 WP_001126780.1.75786 WP_001126780.1.75808 WP_001126780.1.75839 WP_001126780.1.75892 WP_001126780.1.75918 WP_001126780.1.7597 WP_001126780.1.75999 WP_001126780.1.76005 WP_001126780.1.76019 WP_001126780.1.7603 WP_001126780.1.76030 WP_001126780.1.76036 WP_001126780.1.76039 WP_001126780.1.76057 WP_001126780.1.76087 WP_001126780.1.76103 WP_001126780.1.76119 WP_001126780.1.7613 WP_001126780.1.7617 WP_001126780.1.76184 WP_001126780.1.76194 WP_001126780.1.76196 WP_001126780.1.76211 WP_001126780.1.76237 WP_001126780.1.76268 WP_001126780.1.76269 WP_001126780.1.76305 WP_001126780.1.76312 WP_001126780.1.76325 WP_001126780.1.76335 WP_001126780.1.76387 WP_001126780.1.76390 WP_001126780.1.76462 WP_001126780.1.76469 WP_001126780.1.76504 WP_001126780.1.76547 WP_001126780.1.76562 WP_001126780.1.76596 WP_001126780.1.7661 WP_001126780.1.76619 WP_001126780.1.76643 WP_001126780.1.76660 WP_001126780.1.76701 WP_001126780.1.76751 WP_001126780.1.7680 WP_001126780.1.76840 WP_001126780.1.76863 WP_001126780.1.7689 WP_001126780.1.76933 WP_001126780.1.76948 WP_001126780.1.76961 WP_001126780.1.76965 WP_001126780.1.7699 WP_001126780.1.77007 WP_001126780.1.77036 WP_001126780.1.77042 WP_001126780.1.77057 WP_001126780.1.77081 WP_001126780.1.771 WP_001126780.1.77173 WP_001126780.1.77175 WP_001126780.1.77200 WP_001126780.1.77204 WP_001126780.1.77224 WP_001126780.1.77253 WP_001126780.1.77258 WP_001126780.1.7728 WP_001126780.1.7731 WP_001126780.1.77320 WP_001126780.1.77326 WP_001126780.1.77358 WP_001126780.1.77408 WP_001126780.1.77455 WP_001126780.1.7747 WP_001126780.1.77470 WP_001126780.1.77477 WP_001126780.1.77495 WP_001126780.1.77503 WP_001126780.1.77511 WP_001126780.1.77551 WP_001126780.1.7756 WP_001126780.1.77595 WP_001126780.1.77626 WP_001126780.1.77636 WP_001126780.1.77643 WP_001126780.1.77657 WP_001126780.1.7775 WP_001126780.1.77768 WP_001126780.1.7780 WP_001126780.1.7781 WP_001126780.1.77816 WP_001126780.1.77833 WP_001126780.1.77876 WP_001126780.1.77949 WP_001126780.1.78000 WP_001126780.1.78010 WP_001126780.1.7804 WP_001126780.1.7808 WP_001126780.1.78089 WP_001126780.1.78101 WP_001126780.1.78131 WP_001126780.1.78183 WP_001126780.1.78187 WP_001126780.1.78196 WP_001126780.1.78232 WP_001126780.1.78305 WP_001126780.1.78321 WP_001126780.1.78368 WP_001126780.1.78376 WP_001126780.1.78453 WP_001126780.1.78463 WP_001126780.1.78481 WP_001126780.1.78491 WP_001126780.1.78512 WP_001126780.1.78572 WP_001126780.1.78575 WP_001126780.1.78583 WP_001126780.1.78610 WP_001126780.1.78612 WP_001126780.1.78615 WP_001126780.1.78677 WP_001126780.1.78683 WP_001126780.1.78687 WP_001126780.1.78689 WP_001126780.1.78714 WP_001126780.1.78718 WP_001126780.1.78750 WP_001126780.1.78791 WP_001126780.1.78814 WP_001126780.1.78845 WP_001126780.1.78854 WP_001126780.1.78893 WP_001126780.1.78895 WP_001126780.1.78908 WP_001126780.1.78953 WP_001126780.1.78955 WP_001126780.1.78956 WP_001126780.1.7896 WP_001126780.1.78966 WP_001126780.1.7898 WP_001126780.1.78996 WP_001126780.1.79001 WP_001126780.1.79004 WP_001126780.1.79065 WP_001126780.1.79086 WP_001126780.1.79100 WP_001126780.1.79159 WP_001126780.1.79243 WP_001126780.1.79248 WP_001126780.1.79249 WP_001126780.1.79276 WP_001126780.1.79306 WP_001126780.1.79312 WP_001126780.1.79342 WP_001126780.1.79348 WP_001126780.1.79356 WP_001126780.1.79365 WP_001126780.1.7937 WP_001126780.1.79409 WP_001126780.1.79414 WP_001126780.1.79443 WP_001126780.1.79478 WP_001126780.1.79505 WP_001126780.1.79525 WP_001126780.1.79526 WP_001126780.1.79540 WP_001126780.1.79558 WP_001126780.1.79591 WP_001126780.1.79619 WP_001126780.1.7967 WP_001126780.1.79685 WP_001126780.1.79707 WP_001126780.1.79749 WP_001126780.1.79764 WP_001126780.1.79816 WP_001126780.1.79840 WP_001126780.1.79866 WP_001126780.1.7987 WP_001126780.1.79871 WP_001126780.1.79877 WP_001126780.1.79930 WP_001126780.1.79931 WP_001126780.1.79932 WP_001126780.1.79933 WP_001126780.1.79952 WP_001126780.1.79955 WP_001126780.1.79973 WP_001126780.1.79984 WP_001126780.1.79995 WP_001126780.1.80 WP_001126780.1.80016 WP_001126780.1.80026 WP_001126780.1.80043 WP_001126780.1.80050 WP_001126780.1.80096 WP_001126780.1.80106 WP_001126780.1.8011 WP_001126780.1.80112 WP_001126780.1.80176 WP_001126780.1.80183 WP_001126780.1.80255 WP_001126780.1.80320 WP_001126780.1.80343 WP_001126780.1.80392 WP_001126780.1.804 WP_001126780.1.80402 WP_001126780.1.80426 WP_001126780.1.80428 WP_001126780.1.80440 WP_001126780.1.80444 WP_001126780.1.80517 WP_001126780.1.80519 WP_001126780.1.80558 WP_001126780.1.80559 WP_001126780.1.8057 WP_001126780.1.80577 WP_001126780.1.80737 WP_001126780.1.80756 WP_001126780.1.8076 WP_001126780.1.80768 WP_001126780.1.80804 WP_001126780.1.80884 WP_001126780.1.80894 WP_001126780.1.8090 WP_001126780.1.80935 WP_001126780.1.80948 WP_001126780.1.81032 WP_001126780.1.81034 WP_001126780.1.81036 WP_001126780.1.81056 WP_001126780.1.81098 WP_001126780.1.811 WP_001126780.1.81104 WP_001126780.1.81120 WP_001126780.1.81127 WP_001126780.1.81141 WP_001126780.1.81156 WP_001126780.1.81165 WP_001126780.1.8118 WP_001126780.1.81182 WP_001126780.1.81186 WP_001126780.1.81219 WP_001126780.1.81266 WP_001126780.1.81283 WP_001126780.1.81313 WP_001126780.1.81316 WP_001126780.1.81323 WP_001126780.1.81347 WP_001126780.1.81391 WP_001126780.1.81396 WP_001126780.1.814 WP_001126780.1.81418 WP_001126780.1.81438 WP_001126780.1.81469 WP_001126780.1.81475 WP_001126780.1.81484 WP_001126780.1.81576 WP_001126780.1.81577 WP_001126780.1.81588 WP_001126780.1.81589 WP_001126780.1.81624 WP_001126780.1.81715 WP_001126780.1.81761 WP_001126780.1.81806 WP_001126780.1.81832 WP_001126780.1.81888 WP_001126780.1.81935 WP_001126780.1.81939 WP_001126780.1.82008 WP_001126780.1.82059 WP_001126780.1.82074 WP_001126780.1.82104 WP_001126780.1.82106 WP_001126780.1.82123 WP_001126780.1.82166 WP_001126780.1.82217 WP_001126780.1.82221 WP_001126780.1.82239 WP_001126780.1.82240 WP_001126780.1.82246 WP_001126780.1.82275 WP_001126780.1.82316 WP_001126780.1.8235 WP_001126780.1.82378 WP_001126780.1.82439 WP_001126780.1.82485 WP_001126780.1.82499 WP_001126780.1.82514 WP_001126780.1.82527 WP_001126780.1.82536 WP_001126780.1.82539 WP_001126780.1.8255 WP_001126780.1.82589 WP_001126780.1.82626 WP_001126780.1.82647 WP_001126780.1.82661 WP_001126780.1.82700 WP_001126780.1.82711 WP_001126780.1.82715 WP_001126780.1.82718 WP_001126780.1.82747 WP_001126780.1.82754 WP_001126780.1.8277 WP_001126780.1.82784 WP_001126780.1.82799 WP_001126780.1.82816 WP_001126780.1.82831 WP_001126780.1.82833 WP_001126780.1.82901 WP_001126780.1.82902 WP_001126780.1.82991 WP_001126780.1.83020 WP_001126780.1.83035 WP_001126780.1.83036 WP_001126780.1.83059 WP_001126780.1.8306 WP_001126780.1.8308 WP_001126780.1.83093 WP_001126780.1.83097 WP_001126780.1.831 WP_001126780.1.83118 WP_001126780.1.83125 WP_001126780.1.83127 WP_001126780.1.83140 WP_001126780.1.83218 WP_001126780.1.83224 WP_001126780.1.83238 WP_001126780.1.83253 WP_001126780.1.83256 WP_001126780.1.83313 WP_001126780.1.83375 WP_001126780.1.83393 WP_001126780.1.83415 WP_001126780.1.8345 WP_001126780.1.83481 WP_001126780.1.83506 WP_001126780.1.83537 WP_001126780.1.83544 WP_001126780.1.83582 WP_001126780.1.83644 WP_001126780.1.83668 WP_001126780.1.8368 WP_001126780.1.83684 WP_001126780.1.83735 WP_001126780.1.83762 WP_001126780.1.83781 WP_001126780.1.83807 WP_001126780.1.83820 WP_001126780.1.8386 WP_001126780.1.83911 WP_001126780.1.83936 WP_001126780.1.83941 WP_001126780.1.83947 WP_001126780.1.84004 WP_001126780.1.84014 WP_001126780.1.8405 WP_001126780.1.84059 WP_001126780.1.84060 WP_001126780.1.8408 WP_001126780.1.8411 WP_001126780.1.84172 WP_001126780.1.84197 WP_001126780.1.84215 WP_001126780.1.84221 WP_001126780.1.84298 WP_001126780.1.84313 WP_001126780.1.84316 WP_001126780.1.84326 WP_001126780.1.84331 WP_001126780.1.84402 WP_001126780.1.84405 WP_001126780.1.84410 WP_001126780.1.84436 WP_001126780.1.84464 WP_001126780.1.84467 WP_001126780.1.8447 WP_001126780.1.84473 WP_001126780.1.84476 WP_001126780.1.84511 WP_001126780.1.84531 WP_001126780.1.84534 WP_001126780.1.84584 WP_001126780.1.84639 WP_001126780.1.84668 WP_001126780.1.84697 WP_001126780.1.8470 WP_001126780.1.84738 WP_001126780.1.84740 WP_001126780.1.84797 WP_001126780.1.84841 WP_001126780.1.84850 WP_001126780.1.84877 WP_001126780.1.84893 WP_001126780.1.84929 WP_001126780.1.84948 WP_001126780.1.84966 WP_001126780.1.84972 WP_001126780.1.84977 WP_001126780.1.84989 WP_001126780.1.84994 WP_001126780.1.85002 WP_001126780.1.85025 WP_001126780.1.85052 WP_001126780.1.85077 WP_001126780.1.85085 WP_001126780.1.85090 WP_001126780.1.85106 WP_001126780.1.85112 WP_001126780.1.85138 WP_001126780.1.85175 WP_001126780.1.85188 WP_001126780.1.85216 WP_001126780.1.85247 WP_001126780.1.85252 WP_001126780.1.85255 WP_001126780.1.85260 WP_001126780.1.8530 WP_001126780.1.85315 WP_001126780.1.85320 WP_001126780.1.85323 WP_001126780.1.85329 WP_001126780.1.85335 WP_001126780.1.85342 WP_001126780.1.85384 WP_001126780.1.85504 WP_001126780.1.85525 WP_001126780.1.85554 WP_001126780.1.85556 WP_001126780.1.85578 WP_001126780.1.85593 WP_001126780.1.85621 WP_001126780.1.85623 WP_001126780.1.8564 WP_001126780.1.85657 WP_001126780.1.85752 WP_001126780.1.85773 WP_001126780.1.85781 WP_001126780.1.8579 WP_001126780.1.85857 WP_001126780.1.8592 WP_001126780.1.85948 WP_001126780.1.86001 WP_001126780.1.8603 WP_001126780.1.86104 WP_001126780.1.86115 WP_001126780.1.86149 WP_001126780.1.86176 WP_001126780.1.86179 WP_001126780.1.86181 WP_001126780.1.86189 WP_001126780.1.86196 WP_001126780.1.8621 WP_001126780.1.86227 WP_001126780.1.86228 WP_001126780.1.86234 WP_001126780.1.86261 WP_001126780.1.86263 WP_001126780.1.86266 WP_001126780.1.86273 WP_001126780.1.86276 WP_001126780.1.86283 WP_001126780.1.86307 WP_001126780.1.86353 WP_001126780.1.86355 WP_001126780.1.86371 WP_001126780.1.86411 WP_001126780.1.86412 WP_001126780.1.86437 WP_001126780.1.86452 WP_001126780.1.86461 WP_001126780.1.86475 WP_001126780.1.86492 WP_001126780.1.8656 WP_001126780.1.86560 WP_001126780.1.86583 WP_001126780.1.86586 WP_001126780.1.86609 WP_001126780.1.86613 WP_001126780.1.86617 WP_001126780.1.86640 WP_001126780.1.86673 WP_001126780.1.86674 WP_001126780.1.86691 WP_001126780.1.86727 WP_001126780.1.86734 WP_001126780.1.86753 WP_001126780.1.86760 WP_001126780.1.86768 WP_001126780.1.86787 WP_001126780.1.86833 WP_001126780.1.86848 WP_001126780.1.8687 WP_001126780.1.86956 WP_001126780.1.86959 WP_001126780.1.86997 WP_001126780.1.87043 WP_001126780.1.8705 WP_001126780.1.87074 WP_001126780.1.87102 WP_001126780.1.87109 WP_001126780.1.87147 WP_001126780.1.87199 WP_001126780.1.87205 WP_001126780.1.87249 WP_001126780.1.87371 WP_001126780.1.87389 WP_001126780.1.87443 WP_001126780.1.87504 WP_001126780.1.87563 WP_001126780.1.87568 WP_001126780.1.87574 WP_001126780.1.87581 WP_001126780.1.87590 WP_001126780.1.87633 WP_001126780.1.87675 WP_001126780.1.87696 WP_001126780.1.87728 WP_001126780.1.87738 WP_001126780.1.87766 WP_001126780.1.8778 WP_001126780.1.87788 WP_001126780.1.87789 WP_001126780.1.87857 WP_001126780.1.87883 WP_001126780.1.87914 WP_001126780.1.87973 WP_001126780.1.87980 WP_001126780.1.87990 WP_001126780.1.88017 WP_001126780.1.8807 WP_001126780.1.88088 WP_001126780.1.88110 WP_001126780.1.88119 WP_001126780.1.88147 WP_001126780.1.88149 WP_001126780.1.88155 WP_001126780.1.8822 WP_001126780.1.88234 WP_001126780.1.88238 WP_001126780.1.88252 WP_001126780.1.88260 WP_001126780.1.88285 WP_001126780.1.88301 WP_001126780.1.88336 WP_001126780.1.88376 WP_001126780.1.88379 WP_001126780.1.88384 WP_001126780.1.88434 WP_001126780.1.88462 WP_001126780.1.8848 WP_001126780.1.88499 WP_001126780.1.88505 WP_001126780.1.88527 WP_001126780.1.88539 WP_001126780.1.8855 WP_001126780.1.88562 WP_001126780.1.88607 WP_001126780.1.88646 WP_001126780.1.88686 WP_001126780.1.88709 WP_001126780.1.88711 WP_001126780.1.88717 WP_001126780.1.88729 WP_001126780.1.88732 WP_001126780.1.88752 WP_001126780.1.88759 WP_001126780.1.88767 WP_001126780.1.88793 WP_001126780.1.88826 WP_001126780.1.88834 WP_001126780.1.88880 WP_001126780.1.88941 WP_001126780.1.88950 WP_001126780.1.88953 WP_001126780.1.88961 WP_001126780.1.88997 WP_001126780.1.89043 WP_001126780.1.89050 WP_001126780.1.8906 WP_001126780.1.89069 WP_001126780.1.89090 WP_001126780.1.89099 WP_001126780.1.89150 WP_001126780.1.89163 WP_001126780.1.89183 WP_001126780.1.89197 WP_001126780.1.89203 WP_001126780.1.89214 WP_001126780.1.89217 WP_001126780.1.8928 WP_001126780.1.89285 WP_001126780.1.89312 WP_001126780.1.89334 WP_001126780.1.89335 WP_001126780.1.89351 WP_001126780.1.89379 WP_001126780.1.8938 WP_001126780.1.894 WP_001126780.1.89427 WP_001126780.1.89455 WP_001126780.1.89458 WP_001126780.1.89469 WP_001126780.1.89471 WP_001126780.1.89474 WP_001126780.1.89492 WP_001126780.1.89601 WP_001126780.1.89627 WP_001126780.1.89630 WP_001126780.1.89631 WP_001126780.1.89646 WP_001126780.1.89674 WP_001126780.1.89679 WP_001126780.1.89700 WP_001126780.1.89710 WP_001126780.1.89747 WP_001126780.1.89879 WP_001126780.1.89895 WP_001126780.1.89899 WP_001126780.1.89917 WP_001126780.1.89923 WP_001126780.1.89927 WP_001126780.1.89977 WP_001126780.1.90017 WP_001126780.1.90050 WP_001126780.1.90063 WP_001126780.1.90078 WP_001126780.1.90156 WP_001126780.1.90168 WP_001126780.1.90171 WP_001126780.1.902 WP_001126780.1.90256 WP_001126780.1.90270 WP_001126780.1.90346 WP_001126780.1.90357 WP_001126780.1.90358 WP_001126780.1.9036 WP_001126780.1.9037 WP_001126780.1.90389 WP_001126780.1.90405 WP_001126780.1.90435 WP_001126780.1.90449 WP_001126780.1.90467 WP_001126780.1.90511 WP_001126780.1.90520 WP_001126780.1.90525 WP_001126780.1.90536 WP_001126780.1.90542 WP_001126780.1.90591 WP_001126780.1.90602 WP_001126780.1.9061 WP_001126780.1.90626 WP_001126780.1.90690 WP_001126780.1.90703 WP_001126780.1.90706 WP_001126780.1.9081 WP_001126780.1.90822 WP_001126780.1.90828 WP_001126780.1.90834 WP_001126780.1.90839 WP_001126780.1.90842 WP_001126780.1.90844 WP_001126780.1.90864 WP_001126780.1.90865 WP_001126780.1.9087 WP_001126780.1.90873 WP_001126780.1.90890 WP_001126780.1.909 WP_001126780.1.90905 WP_001126780.1.90924 WP_001126780.1.90951 WP_001126780.1.90960 WP_001126780.1.90979 WP_001126780.1.90988 WP_001126780.1.90996 WP_001126780.1.91010 WP_001126780.1.91018 WP_001126780.1.9104 WP_001126780.1.91094 WP_001126780.1.91113 WP_001126780.1.91121 WP_001126780.1.91143 WP_001126780.1.91170 WP_001126780.1.91182 WP_001126780.1.9119 WP_001126780.1.91213 WP_001126780.1.91220 WP_001126780.1.91268 WP_001126780.1.91277 WP_001126780.1.91340 WP_001126780.1.91341 WP_001126780.1.91354 WP_001126780.1.91414 WP_001126780.1.91445 WP_001126780.1.91462 WP_001126780.1.91482 WP_001126780.1.915 WP_001126780.1.91511 WP_001126780.1.91515 WP_001126780.1.91516 WP_001126780.1.91551 WP_001126780.1.91565 WP_001126780.1.91566 WP_001126780.1.9157 WP_001126780.1.91596 WP_001126780.1.9160 WP_001126780.1.91640 WP_001126780.1.91643 WP_001126780.1.91644 WP_001126780.1.91666 WP_001126780.1.91739 WP_001126780.1.91756 WP_001126780.1.91814 WP_001126780.1.91843 WP_001126780.1.91863 WP_001126780.1.91879 WP_001126780.1.91887 WP_001126780.1.91893 WP_001126780.1.91951 WP_001126780.1.91954 WP_001126780.1.91959 WP_001126780.1.9199 WP_001126780.1.92005 WP_001126780.1.92014 WP_001126780.1.92048 WP_001126780.1.92053 WP_001126780.1.9209 WP_001126780.1.92096 WP_001126780.1.92102 WP_001126780.1.92163 WP_001126780.1.92180 WP_001126780.1.92201 WP_001126780.1.92215 WP_001126780.1.92276 WP_001126780.1.92295 WP_001126780.1.92304 WP_001126780.1.92305 WP_001126780.1.92311 WP_001126780.1.92323 WP_001126780.1.92361 WP_001126780.1.92384 WP_001126780.1.92403 WP_001126780.1.92473 WP_001126780.1.92568 WP_001126780.1.92577 WP_001126780.1.92614 WP_001126780.1.92615 WP_001126780.1.92634 WP_001126780.1.92638 WP_001126780.1.92648 WP_001126780.1.9266 WP_001126780.1.92668 WP_001126780.1.92693 WP_001126780.1.92719 WP_001126780.1.92742 WP_001126780.1.92750 WP_001126780.1.92781 WP_001126780.1.92792 WP_001126780.1.92845 WP_001126780.1.92865 WP_001126780.1.92943 WP_001126780.1.93016 WP_001126780.1.93017 WP_001126780.1.93019 WP_001126780.1.93048 WP_001126780.1.93054 WP_001126780.1.93100 WP_001126780.1.93112 WP_001126780.1.93138 WP_001126780.1.93139 WP_001126780.1.93175 WP_001126780.1.93185 WP_001126780.1.93233 WP_001126780.1.93252 WP_001126780.1.9327 WP_001126780.1.93276 WP_001126780.1.93291 WP_001126780.1.93309 WP_001126780.1.93312 WP_001126780.1.93326 WP_001126780.1.93388 WP_001126780.1.934 WP_001126780.1.93431 WP_001126780.1.93453 WP_001126780.1.93461 WP_001126780.1.93463 WP_001126780.1.93464 WP_001126780.1.93509 WP_001126780.1.93531 WP_001126780.1.93533 WP_001126780.1.93552 WP_001126780.1.93569 WP_001126780.1.93626 WP_001126780.1.93634 WP_001126780.1.93639 WP_001126780.1.93652 WP_001126780.1.93665 WP_001126780.1.93673 WP_001126780.1.93679 WP_001126780.1.93694 WP_001126780.1.93716 WP_001126780.1.93733 WP_001126780.1.93737 WP_001126780.1.93745 WP_001126780.1.93755 WP_001126780.1.93870 WP_001126780.1.93873 WP_001126780.1.93911 WP_001126780.1.93922 WP_001126780.1.93951 WP_001126780.1.93952 WP_001126780.1.93971 WP_001126780.1.94008 WP_001126780.1.94025 WP_001126780.1.94028 WP_001126780.1.94035 WP_001126780.1.94040 WP_001126780.1.94057 WP_001126780.1.94069 WP_001126780.1.94156 WP_001126780.1.94176 WP_001126780.1.9420 WP_001126780.1.94232 WP_001126780.1.94271 WP_001126780.1.94282 WP_001126780.1.94298 WP_001126780.1.94317 WP_001126780.1.94353 WP_001126780.1.94388 WP_001126780.1.94404 WP_001126780.1.94417 WP_001126780.1.94430 WP_001126780.1.94438 WP_001126780.1.94445 WP_001126780.1.94446 WP_001126780.1.94475 WP_001126780.1.94542 WP_001126780.1.94548 WP_001126780.1.9457 WP_001126780.1.94580 WP_001126780.1.94619 WP_001126780.1.94626 WP_001126780.1.94646 WP_001126780.1.94686 WP_001126780.1.94692 WP_001126780.1.94695 WP_001126780.1.94704 WP_001126780.1.94738 WP_001126780.1.9474 WP_001126780.1.94754 WP_001126780.1.948 WP_001126780.1.94806 WP_001126780.1.94836 WP_001126780.1.94847 WP_001126780.1.94869 WP_001126780.1.94880 WP_001126780.1.94889 WP_001126780.1.9489 WP_001126780.1.94892 WP_001126780.1.94898 WP_001126780.1.94903 WP_001126780.1.9491 WP_001126780.1.94927 WP_001126780.1.94938 WP_001126780.1.94949 WP_001126780.1.94955 WP_001126780.1.94997 WP_001126780.1.95005 WP_001126780.1.95022 WP_001126780.1.95037 WP_001126780.1.95062 WP_001126780.1.95080 WP_001126780.1.95084 WP_001126780.1.95105 WP_001126780.1.95161 WP_001126780.1.95243 WP_001126780.1.95244 WP_001126780.1.95275 WP_001126780.1.95310 WP_001126780.1.95329 WP_001126780.1.95332 WP_001126780.1.95364 WP_001126780.1.95366 WP_001126780.1.95368 WP_001126780.1.95378 WP_001126780.1.95390 WP_001126780.1.95395 WP_001126780.1.95398 WP_001126780.1.95428 WP_001126780.1.95438 WP_001126780.1.95449 WP_001126780.1.95490 WP_001126780.1.9559 WP_001126780.1.95595 WP_001126780.1.95628 WP_001126780.1.95634 WP_001126780.1.9566 WP_001126780.1.95666 WP_001126780.1.95783 WP_001126780.1.95784 WP_001126780.1.95801 WP_001126780.1.95827 WP_001126780.1.95846 WP_001126780.1.95849 WP_001126780.1.95858 WP_001126780.1.95869 WP_001126780.1.95919 WP_001126780.1.95929 WP_001126780.1.95931 WP_001126780.1.95951 WP_001126780.1.96015 WP_001126780.1.96086 WP_001126780.1.96097 WP_001126780.1.96110 WP_001126780.1.96114 WP_001126780.1.96143 WP_001126780.1.96145 WP_001126780.1.96215 WP_001126780.1.96223 WP_001126780.1.96253 WP_001126780.1.96263 WP_001126780.1.96279 WP_001126780.1.96281 WP_001126780.1.96290 WP_001126780.1.96299 WP_001126780.1.96339 WP_001126780.1.96394 WP_001126780.1.9641 WP_001126780.1.96417 WP_001126780.1.96457 WP_001126780.1.96478 WP_001126780.1.9649 WP_001126780.1.96494 WP_001126780.1.96558 WP_001126780.1.96562 WP_001126780.1.9657 WP_001126780.1.96585 WP_001126780.1.96609 WP_001126780.1.96617 WP_001126780.1.96633 WP_001126780.1.96676 WP_001126780.1.9668 WP_001126780.1.96695 WP_001126780.1.9671 WP_001126780.1.96762 WP_001126780.1.96797 WP_001126780.1.96817 WP_001126780.1.96864 WP_001126780.1.96894 WP_001126780.1.9690 WP_001126780.1.96907 WP_001126780.1.96936 WP_001126780.1.96984 WP_001126780.1.97011 WP_001126780.1.97123 WP_001126780.1.97147 WP_001126780.1.97170 WP_001126780.1.97226 WP_001126780.1.97238 WP_001126780.1.97282 WP_001126780.1.97292 WP_001126780.1.97351 WP_001126780.1.97356 WP_001126780.1.97387 WP_001126780.1.97418 WP_001126780.1.97437 WP_001126780.1.97459 WP_001126780.1.97464 WP_001126780.1.9747 WP_001126780.1.97490 WP_001126780.1.97525 WP_001126780.1.97571 WP_001126780.1.97619 WP_001126780.1.97654 WP_001126780.1.97667 WP_001126780.1.97677 WP_001126780.1.97770 WP_001126780.1.97778 WP_001126780.1.97823 WP_001126780.1.97825 WP_001126780.1.97930 WP_001126780.1.97932 WP_001126780.1.97937 WP_001126780.1.98005 WP_001126780.1.98012 WP_001126780.1.98026 WP_001126780.1.98082 WP_001126780.1.98102 WP_001126780.1.98139 WP_001126780.1.9817 WP_001126780.1.98202 WP_001126780.1.98235 WP_001126780.1.98244 WP_001126780.1.98251 WP_001126780.1.98292 WP_001126780.1.98294 WP_001126780.1.98301 WP_001126780.1.98355 WP_001126780.1.98400 WP_001126780.1.98404 WP_001126780.1.98424 WP_001126780.1.98442 WP_001126780.1.98466 WP_001126780.1.98477 WP_001126780.1.98480 WP_001126780.1.98484 WP_001126780.1.9858 WP_001126780.1.98626 WP_001126780.1.98628 WP_001126780.1.98633 WP_001126780.1.98665 WP_001126780.1.98683 WP_001126780.1.98727 WP_001126780.1.98757 WP_001126780.1.98775 WP_001126780.1.98776 WP_001126780.1.98784 WP_001126780.1.98875 WP_001126780.1.98988 WP_001126780.1.99029 WP_001126780.1.99060 WP_001126780.1.99168 WP_001126780.1.99209 WP_001126780.1.99246 WP_001126780.1.9930 WP_001126780.1.99302 WP_001126780.1.99307 WP_001126780.1.99310 WP_001126780.1.99319 WP_001126780.1.99334 WP_001126780.1.99345 WP_001126780.1.9935 WP_001126780.1.99361 WP_001126780.1.99366 WP_001126780.1.9940 WP_001126780.1.99400 WP_001126780.1.99401 WP_001126780.1.99453 WP_001126780.1.99458 WP_001126780.1.99471 WP_001126780.1.99472 WP_001126780.1.99498 WP_001126780.1.9950 WP_001126780.1.99511 WP_001126780.1.99534 WP_001126780.1.99549 WP_001126780.1.99562 WP_001126780.1.99571 WP_001126780.1.99602 WP_001126780.1.99603 WP_001126780.1.99632 WP_001126780.1.99666 WP_001126780.1.99694 WP_001126780.1.99698 WP_001126780.1.99771 WP_001126780.1.99827 WP_001126780.1.99874 WP_001126780.1.99891 WP_001126780.1.99892 WP_001126780.1.99929 YP_002408108.1.10275 YP_402645.1.10455 gi|238900270|ref|YP_002926066.1| gi|218553599|ref|YP_002386512.1| gi|544575394|ref|YP_008570918.1| gi|386623465|ref|YP_006143193.1| gi|560155966|ref|YP_008848681.1| gi|26247032|ref|NP_753072.1| gi|471333056|ref|YP_007556533.1| gi|16128976|ref|NP_415530.1| gi|388477095|ref|YP_489283.1| gi|157160534|ref|YP_001457852.1| gi|117623206|ref|YP_852119.1| 199310.c1147 300267.SDY_0985 316385.ECDH10B_1082 316407.ycdK 331111.EcE24377A_1128 331112.EcHS_A1125 362663.ECP_1009 364106.UTI89_C1073 405955.APECO1_101 413997.ECB_01013 439855.EcSMS35_2115 469008.ECBD_2584 481805.EcolC_2585 511145.b1010 574521.E2348C_1061 585034.ECIAI1_1055 585035.ECS88_1026 585057.ECIAI39_2145 585395.ECO103_1056 585397.ECED1_1166 595496.BWG_0864 gi|386628536|ref|YP_006148256.1| gi|387606544|ref|YP_006095400.1| gi|260843257|ref|YP_003221035.1| gi|386704188|ref|YP_006168035.1| gi|254161123|ref|YP_003044231.1| gi|386618598|ref|YP_006138178.1| gi|387611552|ref|YP_006114668.1| gi|218557900|ref|YP_002390813.1| gi|253773960|ref|YP_003036791.1| gi|387828969|ref|YP_003348906.1| gi|218688975|ref|YP_002397187.1| gi|387620738|ref|YP_006128365.1| gi|386638342|ref|YP_006105140.1| gi|386598771|ref|YP_006100277.1| gi|91210102|ref|YP_540088.1| gi|386605093|ref|YP_006111393.1| gi|215486190|ref|YP_002328621.1| gi|170020589|ref|YP_001725543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]