SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386619377|ref|YP_006138957.1| from Escherichia coli NA114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386619377|ref|YP_006138957.1|
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily YjgF-like 2.67e-27
Family YjgF/L-PSP 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386619377|ref|YP_006138957.1|
Sequence length 114
Comment hypothetical protein ECNA114_1855 [Escherichia coli NA114]
Sequence
MTIVRIDAEARWSDVVIHNNTLYYTGVPENLDADAFEQTANTLAQIDAVLEKQGSNKSSI
LDATIFLADKNDFAAMNKAWDAWVVAGHAPVRCTVQAGLMNPKYKVEIKIVAAV
Download sequence
Identical sequences A0A025CPC7 A0A026V3G0 A0A027TS16 A0A027ZLT4 A0A028E2H2 A0A069XFE6 A0A070VDY7 A0A073FWP2 A0A073HEV6 A0A073URP1 A0A074I1N2 A0A080FXD0 A0A080IZB1 A0A0E0TZT9 A0A0E0XYE7 A0A0E1T033 A0A0E2TPL0 A0A0F6F7G4 A0A0G3K3C9 A0A0H3MK11 A0A0H3PV66 A0A125X1W6 A0A127GTI3 A0A142H902 A0A1E3MVH6 A0A1Q8MF46 A0A1R3ZJD1 A0A1S6TKB0 A0A1W2MNE5 A0A1Z3UQV8 A0A2H1BGZ7 A7ZMT1 B1LD64 B2U444 B6IBN5 B7L6T7 B7NBF5 D6HXU0 D6IBB9 D6JA88 E0J515 E2XGM4 E3PNJ3 E3XP20 E7TH62 F5N2K3 G0F6S5 H4IBT7 H4ISP6 H4J8Z3 H4KHS9 H4LCP3 H4UK25 I2S3J8 I2SPB2 I2WTP3 I2XEA1 I6BSW4 I6CVB0 I6E5T9 I6H4Q0 K0XGW0 K4UXK6 K4W2F6 L3P5S4 L3Q6M0 M9G6Z9 P0AEB7 P0AEB8 P0AEB9 S1DSM1 S1GVF0 S1I6Y9 S1IIZ1 V6FSU1 V8FMN9 W8SY87
gi|254793431|ref|YP_003078268.1| gi|251785257|ref|YP_002999561.1| 316385.ECDH10B_1947 316407.yoaB 331111.EcE24377A_2036 331112.EcHS_A1897 344609.SbBS512_E2069 409438.ECSE_1983 413997.ECB_01779 439855.EcSMS35_1379 444450.ECH74115_2536 511145.b1809 544404.ECSP_2381 585034.ECIAI1_1878 585055.EC55989_1982 585056.ECUMN_2101 585057.ECIAI39_1244 595496.BWG_1622 gi|387507054|ref|YP_006159310.1| gi|386709668|ref|YP_006173389.1| gi|386614364|ref|YP_006134030.1| gi|556551793|ref|YP_008721946.1| gi|407469609|ref|YP_006783948.1| gi|218695371|ref|YP_002403038.1| gi|254161868|ref|YP_003044976.1| gi|471333649|ref|YP_007557126.1| gi|443617886|ref|YP_007381742.1| gi|218554381|ref|YP_002387294.1| gi|407481727|ref|YP_006778876.1| gi|378712752|ref|YP_005277645.1| gi|410482276|ref|YP_006769822.1| gi|90111336|ref|NP_416323.4| gi|386709668|ref|YP_006173389.1| NP_310545.2.58667 NP_416323.4.90541 WP_001295493.1.1000 WP_001295493.1.10001 WP_001295493.1.100014 WP_001295493.1.100044 WP_001295493.1.100052 WP_001295493.1.100063 WP_001295493.1.100066 WP_001295493.1.100073 WP_001295493.1.100085 WP_001295493.1.10010 WP_001295493.1.100111 WP_001295493.1.100116 WP_001295493.1.100135 WP_001295493.1.100138 WP_001295493.1.100159 WP_001295493.1.100185 WP_001295493.1.100194 WP_001295493.1.100227 WP_001295493.1.100251 WP_001295493.1.100252 WP_001295493.1.100281 WP_001295493.1.100283 WP_001295493.1.100285 WP_001295493.1.100299 WP_001295493.1.100302 WP_001295493.1.100304 WP_001295493.1.100306 WP_001295493.1.100315 WP_001295493.1.10034 WP_001295493.1.100346 WP_001295493.1.100389 WP_001295493.1.100425 WP_001295493.1.100441 WP_001295493.1.100444 WP_001295493.1.100447 WP_001295493.1.100448 WP_001295493.1.100451 WP_001295493.1.100474 WP_001295493.1.10048 WP_001295493.1.100487 WP_001295493.1.100496 WP_001295493.1.100499 WP_001295493.1.100508 WP_001295493.1.10051 WP_001295493.1.100543 WP_001295493.1.100554 WP_001295493.1.100571 WP_001295493.1.100573 WP_001295493.1.100614 WP_001295493.1.10067 WP_001295493.1.10068 WP_001295493.1.100685 WP_001295493.1.100688 WP_001295493.1.100689 WP_001295493.1.100718 WP_001295493.1.100725 WP_001295493.1.100752 WP_001295493.1.100753 WP_001295493.1.100758 WP_001295493.1.100778 WP_001295493.1.100796 WP_001295493.1.10080 WP_001295493.1.100803 WP_001295493.1.100824 WP_001295493.1.100836 WP_001295493.1.100851 WP_001295493.1.100852 WP_001295493.1.10086 WP_001295493.1.100867 WP_001295493.1.100868 WP_001295493.1.100916 WP_001295493.1.100925 WP_001295493.1.100928 WP_001295493.1.100933 WP_001295493.1.10094 WP_001295493.1.100950 WP_001295493.1.100966 WP_001295493.1.100990 WP_001295493.1.10100 WP_001295493.1.101033 WP_001295493.1.101087 WP_001295493.1.101096 WP_001295493.1.1011 WP_001295493.1.101102 WP_001295493.1.101105 WP_001295493.1.101110 WP_001295493.1.101121 WP_001295493.1.101148 WP_001295493.1.101157 WP_001295493.1.101158 WP_001295493.1.101166 WP_001295493.1.101175 WP_001295493.1.101186 WP_001295493.1.101206 WP_001295493.1.101214 WP_001295493.1.101216 WP_001295493.1.101255 WP_001295493.1.101257 WP_001295493.1.10126 WP_001295493.1.101282 WP_001295493.1.101289 WP_001295493.1.101293 WP_001295493.1.10131 WP_001295493.1.101313 WP_001295493.1.101359 WP_001295493.1.10138 WP_001295493.1.101387 WP_001295493.1.101399 WP_001295493.1.101418 WP_001295493.1.101423 WP_001295493.1.101430 WP_001295493.1.101436 WP_001295493.1.101439 WP_001295493.1.101445 WP_001295493.1.101468 WP_001295493.1.101486 WP_001295493.1.101518 WP_001295493.1.101522 WP_001295493.1.10154 WP_001295493.1.101545 WP_001295493.1.101583 WP_001295493.1.101586 WP_001295493.1.101594 WP_001295493.1.101628 WP_001295493.1.101630 WP_001295493.1.101651 WP_001295493.1.101653 WP_001295493.1.101654 WP_001295493.1.101667 WP_001295493.1.101668 WP_001295493.1.101686 WP_001295493.1.101693 WP_001295493.1.101700 WP_001295493.1.101727 WP_001295493.1.10173 WP_001295493.1.101737 WP_001295493.1.101747 WP_001295493.1.101777 WP_001295493.1.101786 WP_001295493.1.10181 WP_001295493.1.101822 WP_001295493.1.10184 WP_001295493.1.101840 WP_001295493.1.101845 WP_001295493.1.101855 WP_001295493.1.101865 WP_001295493.1.10187 WP_001295493.1.10188 WP_001295493.1.101887 WP_001295493.1.101889 WP_001295493.1.10190 WP_001295493.1.101900 WP_001295493.1.101908 WP_001295493.1.101913 WP_001295493.1.101932 WP_001295493.1.101937 WP_001295493.1.101940 WP_001295493.1.101942 WP_001295493.1.101947 WP_001295493.1.101948 WP_001295493.1.101952 WP_001295493.1.101964 WP_001295493.1.101969 WP_001295493.1.101977 WP_001295493.1.101984 WP_001295493.1.101987 WP_001295493.1.102021 WP_001295493.1.102036 WP_001295493.1.10206 WP_001295493.1.102069 WP_001295493.1.102076 WP_001295493.1.102093 WP_001295493.1.102094 WP_001295493.1.102104 WP_001295493.1.102106 WP_001295493.1.102122 WP_001295493.1.102139 WP_001295493.1.10222 WP_001295493.1.10226 WP_001295493.1.10233 WP_001295493.1.10235 WP_001295493.1.10252 WP_001295493.1.10273 WP_001295493.1.10304 WP_001295493.1.10329 WP_001295493.1.10335 WP_001295493.1.10348 WP_001295493.1.10352 WP_001295493.1.10361 WP_001295493.1.10379 WP_001295493.1.10381 WP_001295493.1.1040 WP_001295493.1.10400 WP_001295493.1.10417 WP_001295493.1.10461 WP_001295493.1.10476 WP_001295493.1.10491 WP_001295493.1.10496 WP_001295493.1.10508 WP_001295493.1.10524 WP_001295493.1.10525 WP_001295493.1.10538 WP_001295493.1.10569 WP_001295493.1.10573 WP_001295493.1.10576 WP_001295493.1.10579 WP_001295493.1.1058 WP_001295493.1.10605 WP_001295493.1.10607 WP_001295493.1.10628 WP_001295493.1.10651 WP_001295493.1.10673 WP_001295493.1.10705 WP_001295493.1.1071 WP_001295493.1.10715 WP_001295493.1.10729 WP_001295493.1.1073 WP_001295493.1.1074 WP_001295493.1.10748 WP_001295493.1.10761 WP_001295493.1.10763 WP_001295493.1.10771 WP_001295493.1.10786 WP_001295493.1.10787 WP_001295493.1.10798 WP_001295493.1.10809 WP_001295493.1.10814 WP_001295493.1.10824 WP_001295493.1.10833 WP_001295493.1.10842 WP_001295493.1.10849 WP_001295493.1.10862 WP_001295493.1.10869 WP_001295493.1.10922 WP_001295493.1.10940 WP_001295493.1.10970 WP_001295493.1.10988 WP_001295493.1.10989 WP_001295493.1.10994 WP_001295493.1.10995 WP_001295493.1.11006 WP_001295493.1.11032 WP_001295493.1.11047 WP_001295493.1.11052 WP_001295493.1.11068 WP_001295493.1.11071 WP_001295493.1.11091 WP_001295493.1.1111 WP_001295493.1.11113 WP_001295493.1.11118 WP_001295493.1.1113 WP_001295493.1.11133 WP_001295493.1.112 WP_001295493.1.1122 WP_001295493.1.11240 WP_001295493.1.11241 WP_001295493.1.11251 WP_001295493.1.11265 WP_001295493.1.11272 WP_001295493.1.11285 WP_001295493.1.11296 WP_001295493.1.11301 WP_001295493.1.11315 WP_001295493.1.11323 WP_001295493.1.11408 WP_001295493.1.11411 WP_001295493.1.11418 WP_001295493.1.11436 WP_001295493.1.11437 WP_001295493.1.11440 WP_001295493.1.11452 WP_001295493.1.11467 WP_001295493.1.11499 WP_001295493.1.11524 WP_001295493.1.11542 WP_001295493.1.11575 WP_001295493.1.11578 WP_001295493.1.11595 WP_001295493.1.11607 WP_001295493.1.11612 WP_001295493.1.11616 WP_001295493.1.11645 WP_001295493.1.11671 WP_001295493.1.11673 WP_001295493.1.11690 WP_001295493.1.11699 WP_001295493.1.11748 WP_001295493.1.1176 WP_001295493.1.11762 WP_001295493.1.11801 WP_001295493.1.11803 WP_001295493.1.11844 WP_001295493.1.1186 WP_001295493.1.11912 WP_001295493.1.11949 WP_001295493.1.11955 WP_001295493.1.1196 WP_001295493.1.11982 WP_001295493.1.11985 WP_001295493.1.12000 WP_001295493.1.12030 WP_001295493.1.12036 WP_001295493.1.12050 WP_001295493.1.12051 WP_001295493.1.12060 WP_001295493.1.12088 WP_001295493.1.12095 WP_001295493.1.12112 WP_001295493.1.12115 WP_001295493.1.1212 WP_001295493.1.12151 WP_001295493.1.12157 WP_001295493.1.12174 WP_001295493.1.1218 WP_001295493.1.12204 WP_001295493.1.12230 WP_001295493.1.12259 WP_001295493.1.12268 WP_001295493.1.12279 WP_001295493.1.12292 WP_001295493.1.12295 WP_001295493.1.12305 WP_001295493.1.12319 WP_001295493.1.12320 WP_001295493.1.12342 WP_001295493.1.12344 WP_001295493.1.12352 WP_001295493.1.12415 WP_001295493.1.1242 WP_001295493.1.12426 WP_001295493.1.12458 WP_001295493.1.12459 WP_001295493.1.12468 WP_001295493.1.12478 WP_001295493.1.12542 WP_001295493.1.12552 WP_001295493.1.12558 WP_001295493.1.12566 WP_001295493.1.12574 WP_001295493.1.12582 WP_001295493.1.12594 WP_001295493.1.12623 WP_001295493.1.12645 WP_001295493.1.12646 WP_001295493.1.12675 WP_001295493.1.12679 WP_001295493.1.12680 WP_001295493.1.12693 WP_001295493.1.12697 WP_001295493.1.127 WP_001295493.1.12709 WP_001295493.1.12717 WP_001295493.1.12743 WP_001295493.1.12749 WP_001295493.1.1275 WP_001295493.1.12756 WP_001295493.1.12762 WP_001295493.1.12763 WP_001295493.1.12766 WP_001295493.1.12775 WP_001295493.1.1278 WP_001295493.1.12781 WP_001295493.1.1280 WP_001295493.1.12826 WP_001295493.1.12830 WP_001295493.1.12831 WP_001295493.1.12876 WP_001295493.1.12893 WP_001295493.1.12911 WP_001295493.1.12914 WP_001295493.1.12915 WP_001295493.1.1295 WP_001295493.1.12956 WP_001295493.1.12965 WP_001295493.1.12976 WP_001295493.1.12979 WP_001295493.1.12987 WP_001295493.1.12991 WP_001295493.1.13002 WP_001295493.1.13015 WP_001295493.1.13031 WP_001295493.1.13060 WP_001295493.1.13074 WP_001295493.1.1308 WP_001295493.1.13117 WP_001295493.1.1312 WP_001295493.1.13136 WP_001295493.1.1314 WP_001295493.1.13144 WP_001295493.1.1315 WP_001295493.1.13157 WP_001295493.1.13162 WP_001295493.1.13176 WP_001295493.1.13205 WP_001295493.1.13217 WP_001295493.1.13222 WP_001295493.1.13223 WP_001295493.1.13239 WP_001295493.1.13252 WP_001295493.1.13258 WP_001295493.1.13271 WP_001295493.1.13272 WP_001295493.1.13278 WP_001295493.1.13281 WP_001295493.1.13290 WP_001295493.1.13295 WP_001295493.1.13301 WP_001295493.1.13332 WP_001295493.1.13333 WP_001295493.1.13346 WP_001295493.1.13348 WP_001295493.1.1335 WP_001295493.1.13383 WP_001295493.1.13393 WP_001295493.1.13409 WP_001295493.1.13411 WP_001295493.1.13430 WP_001295493.1.13437 WP_001295493.1.13442 WP_001295493.1.1345 WP_001295493.1.13451 WP_001295493.1.13481 WP_001295493.1.13492 WP_001295493.1.13495 WP_001295493.1.13525 WP_001295493.1.13566 WP_001295493.1.13585 WP_001295493.1.13589 WP_001295493.1.13601 WP_001295493.1.13608 WP_001295493.1.13618 WP_001295493.1.13624 WP_001295493.1.13626 WP_001295493.1.13644 WP_001295493.1.13656 WP_001295493.1.13662 WP_001295493.1.13664 WP_001295493.1.13672 WP_001295493.1.13740 WP_001295493.1.13778 WP_001295493.1.13791 WP_001295493.1.13798 WP_001295493.1.13824 WP_001295493.1.13877 WP_001295493.1.13881 WP_001295493.1.13891 WP_001295493.1.13924 WP_001295493.1.13934 WP_001295493.1.13936 WP_001295493.1.13939 WP_001295493.1.13944 WP_001295493.1.13949 WP_001295493.1.13974 WP_001295493.1.13981 WP_001295493.1.14023 WP_001295493.1.14030 WP_001295493.1.14042 WP_001295493.1.14058 WP_001295493.1.14062 WP_001295493.1.14070 WP_001295493.1.14094 WP_001295493.1.14110 WP_001295493.1.14127 WP_001295493.1.14129 WP_001295493.1.14144 WP_001295493.1.14154 WP_001295493.1.14164 WP_001295493.1.1419 WP_001295493.1.14199 WP_001295493.1.142 WP_001295493.1.14245 WP_001295493.1.14253 WP_001295493.1.14277 WP_001295493.1.14292 WP_001295493.1.14299 WP_001295493.1.14304 WP_001295493.1.14322 WP_001295493.1.14346 WP_001295493.1.14371 WP_001295493.1.1438 WP_001295493.1.14389 WP_001295493.1.1439 WP_001295493.1.14398 WP_001295493.1.14417 WP_001295493.1.14432 WP_001295493.1.14451 WP_001295493.1.14453 WP_001295493.1.14468 WP_001295493.1.14493 WP_001295493.1.14499 WP_001295493.1.14501 WP_001295493.1.14506 WP_001295493.1.14508 WP_001295493.1.14529 WP_001295493.1.14536 WP_001295493.1.14538 WP_001295493.1.14581 WP_001295493.1.14582 WP_001295493.1.14601 WP_001295493.1.14607 WP_001295493.1.1461 WP_001295493.1.14621 WP_001295493.1.14648 WP_001295493.1.14661 WP_001295493.1.14672 WP_001295493.1.14678 WP_001295493.1.14687 WP_001295493.1.14693 WP_001295493.1.1470 WP_001295493.1.14711 WP_001295493.1.14712 WP_001295493.1.14748 WP_001295493.1.14749 WP_001295493.1.14807 WP_001295493.1.14811 WP_001295493.1.14833 WP_001295493.1.1486 WP_001295493.1.14861 WP_001295493.1.14871 WP_001295493.1.14879 WP_001295493.1.14934 WP_001295493.1.14935 WP_001295493.1.14946 WP_001295493.1.14956 WP_001295493.1.14958 WP_001295493.1.14965 WP_001295493.1.14977 WP_001295493.1.14992 WP_001295493.1.14993 WP_001295493.1.15007 WP_001295493.1.15020 WP_001295493.1.15041 WP_001295493.1.1508 WP_001295493.1.15087 WP_001295493.1.15090 WP_001295493.1.1510 WP_001295493.1.15117 WP_001295493.1.1512 WP_001295493.1.15121 WP_001295493.1.15138 WP_001295493.1.15148 WP_001295493.1.15177 WP_001295493.1.15191 WP_001295493.1.15193 WP_001295493.1.15207 WP_001295493.1.15221 WP_001295493.1.1524 WP_001295493.1.15245 WP_001295493.1.15252 WP_001295493.1.15259 WP_001295493.1.15270 WP_001295493.1.15274 WP_001295493.1.15277 WP_001295493.1.15282 WP_001295493.1.15287 WP_001295493.1.15290 WP_001295493.1.153 WP_001295493.1.15300 WP_001295493.1.15304 WP_001295493.1.15332 WP_001295493.1.15335 WP_001295493.1.15347 WP_001295493.1.15356 WP_001295493.1.15377 WP_001295493.1.15416 WP_001295493.1.1543 WP_001295493.1.15444 WP_001295493.1.15453 WP_001295493.1.15464 WP_001295493.1.15469 WP_001295493.1.15496 WP_001295493.1.1550 WP_001295493.1.15503 WP_001295493.1.15521 WP_001295493.1.15527 WP_001295493.1.15528 WP_001295493.1.15538 WP_001295493.1.15565 WP_001295493.1.15576 WP_001295493.1.15583 WP_001295493.1.1559 WP_001295493.1.15593 WP_001295493.1.15600 WP_001295493.1.1561 WP_001295493.1.15626 WP_001295493.1.15645 WP_001295493.1.15654 WP_001295493.1.15702 WP_001295493.1.15707 WP_001295493.1.15731 WP_001295493.1.15740 WP_001295493.1.15747 WP_001295493.1.15752 WP_001295493.1.15762 WP_001295493.1.15767 WP_001295493.1.15768 WP_001295493.1.15771 WP_001295493.1.15782 WP_001295493.1.1580 WP_001295493.1.15809 WP_001295493.1.1582 WP_001295493.1.15855 WP_001295493.1.15863 WP_001295493.1.15869 WP_001295493.1.1588 WP_001295493.1.15894 WP_001295493.1.15906 WP_001295493.1.15916 WP_001295493.1.15945 WP_001295493.1.15951 WP_001295493.1.15983 WP_001295493.1.16010 WP_001295493.1.16014 WP_001295493.1.16015 WP_001295493.1.16034 WP_001295493.1.1604 WP_001295493.1.16042 WP_001295493.1.16067 WP_001295493.1.16075 WP_001295493.1.16086 WP_001295493.1.16087 WP_001295493.1.1609 WP_001295493.1.16102 WP_001295493.1.16131 WP_001295493.1.16133 WP_001295493.1.16154 WP_001295493.1.16171 WP_001295493.1.16179 WP_001295493.1.16183 WP_001295493.1.16188 WP_001295493.1.16194 WP_001295493.1.1621 WP_001295493.1.1622 WP_001295493.1.16222 WP_001295493.1.16270 WP_001295493.1.16272 WP_001295493.1.16294 WP_001295493.1.163 WP_001295493.1.16303 WP_001295493.1.16322 WP_001295493.1.1634 WP_001295493.1.16387 WP_001295493.1.16388 WP_001295493.1.16396 WP_001295493.1.1640 WP_001295493.1.16435 WP_001295493.1.16463 WP_001295493.1.16481 WP_001295493.1.16482 WP_001295493.1.16500 WP_001295493.1.16517 WP_001295493.1.16532 WP_001295493.1.16539 WP_001295493.1.16541 WP_001295493.1.1655 WP_001295493.1.16577 WP_001295493.1.16592 WP_001295493.1.16604 WP_001295493.1.16612 WP_001295493.1.16640 WP_001295493.1.16648 WP_001295493.1.16669 WP_001295493.1.16685 WP_001295493.1.16700 WP_001295493.1.16705 WP_001295493.1.16715 WP_001295493.1.16721 WP_001295493.1.1673 WP_001295493.1.16745 WP_001295493.1.16752 WP_001295493.1.16766 WP_001295493.1.16780 WP_001295493.1.16798 WP_001295493.1.16799 WP_001295493.1.16805 WP_001295493.1.16807 WP_001295493.1.16818 WP_001295493.1.16843 WP_001295493.1.16845 WP_001295493.1.16862 WP_001295493.1.16894 WP_001295493.1.16970 WP_001295493.1.16979 WP_001295493.1.16992 WP_001295493.1.17014 WP_001295493.1.17017 WP_001295493.1.17018 WP_001295493.1.17028 WP_001295493.1.17042 WP_001295493.1.17061 WP_001295493.1.17084 WP_001295493.1.17085 WP_001295493.1.17087 WP_001295493.1.17089 WP_001295493.1.1710 WP_001295493.1.17101 WP_001295493.1.17102 WP_001295493.1.17109 WP_001295493.1.17111 WP_001295493.1.17114 WP_001295493.1.17119 WP_001295493.1.17123 WP_001295493.1.17150 WP_001295493.1.17153 WP_001295493.1.17170 WP_001295493.1.17172 WP_001295493.1.17182 WP_001295493.1.17186 WP_001295493.1.17187 WP_001295493.1.17205 WP_001295493.1.17206 WP_001295493.1.17216 WP_001295493.1.17230 WP_001295493.1.17241 WP_001295493.1.17242 WP_001295493.1.1726 WP_001295493.1.17267 WP_001295493.1.17282 WP_001295493.1.17290 WP_001295493.1.17297 WP_001295493.1.17300 WP_001295493.1.17301 WP_001295493.1.1731 WP_001295493.1.17325 WP_001295493.1.17333 WP_001295493.1.17356 WP_001295493.1.17360 WP_001295493.1.17373 WP_001295493.1.17386 WP_001295493.1.17387 WP_001295493.1.17389 WP_001295493.1.17392 WP_001295493.1.17403 WP_001295493.1.17410 WP_001295493.1.17415 WP_001295493.1.17417 WP_001295493.1.17432 WP_001295493.1.17441 WP_001295493.1.17461 WP_001295493.1.17464 WP_001295493.1.17496 WP_001295493.1.17515 WP_001295493.1.17534 WP_001295493.1.1754 WP_001295493.1.1755 WP_001295493.1.17550 WP_001295493.1.17568 WP_001295493.1.17570 WP_001295493.1.17577 WP_001295493.1.17595 WP_001295493.1.17623 WP_001295493.1.17637 WP_001295493.1.1766 WP_001295493.1.17680 WP_001295493.1.1769 WP_001295493.1.17701 WP_001295493.1.17711 WP_001295493.1.1772 WP_001295493.1.17734 WP_001295493.1.17765 WP_001295493.1.17766 WP_001295493.1.17769 WP_001295493.1.1778 WP_001295493.1.17802 WP_001295493.1.17829 WP_001295493.1.17831 WP_001295493.1.17836 WP_001295493.1.17849 WP_001295493.1.17889 WP_001295493.1.17904 WP_001295493.1.17920 WP_001295493.1.17925 WP_001295493.1.17937 WP_001295493.1.17961 WP_001295493.1.17963 WP_001295493.1.17984 WP_001295493.1.18000 WP_001295493.1.18006 WP_001295493.1.18024 WP_001295493.1.18050 WP_001295493.1.18064 WP_001295493.1.18094 WP_001295493.1.18112 WP_001295493.1.18118 WP_001295493.1.18121 WP_001295493.1.18133 WP_001295493.1.18136 WP_001295493.1.18164 WP_001295493.1.18175 WP_001295493.1.18225 WP_001295493.1.18226 WP_001295493.1.18229 WP_001295493.1.18275 WP_001295493.1.18311 WP_001295493.1.18326 WP_001295493.1.18329 WP_001295493.1.18337 WP_001295493.1.18338 WP_001295493.1.1834 WP_001295493.1.18340 WP_001295493.1.18348 WP_001295493.1.18354 WP_001295493.1.18381 WP_001295493.1.18383 WP_001295493.1.18394 WP_001295493.1.18402 WP_001295493.1.18410 WP_001295493.1.18420 WP_001295493.1.18436 WP_001295493.1.18438 WP_001295493.1.1844 WP_001295493.1.18458 WP_001295493.1.18461 WP_001295493.1.18482 WP_001295493.1.18511 WP_001295493.1.18519 WP_001295493.1.18530 WP_001295493.1.18550 WP_001295493.1.18556 WP_001295493.1.18581 WP_001295493.1.18583 WP_001295493.1.1861 WP_001295493.1.18617 WP_001295493.1.1862 WP_001295493.1.18628 WP_001295493.1.18649 WP_001295493.1.18650 WP_001295493.1.1866 WP_001295493.1.18666 WP_001295493.1.1867 WP_001295493.1.18675 WP_001295493.1.18699 WP_001295493.1.18714 WP_001295493.1.18726 WP_001295493.1.1873 WP_001295493.1.188 WP_001295493.1.18801 WP_001295493.1.18802 WP_001295493.1.18806 WP_001295493.1.1881 WP_001295493.1.18828 WP_001295493.1.18837 WP_001295493.1.18843 WP_001295493.1.18858 WP_001295493.1.18861 WP_001295493.1.18874 WP_001295493.1.18876 WP_001295493.1.18899 WP_001295493.1.18908 WP_001295493.1.18923 WP_001295493.1.18929 WP_001295493.1.18934 WP_001295493.1.18936 WP_001295493.1.1896 WP_001295493.1.18962 WP_001295493.1.18966 WP_001295493.1.18983 WP_001295493.1.18995 WP_001295493.1.19024 WP_001295493.1.1903 WP_001295493.1.19036 WP_001295493.1.19039 WP_001295493.1.19075 WP_001295493.1.1909 WP_001295493.1.19090 WP_001295493.1.191 WP_001295493.1.19100 WP_001295493.1.19113 WP_001295493.1.19114 WP_001295493.1.19122 WP_001295493.1.19129 WP_001295493.1.19135 WP_001295493.1.19140 WP_001295493.1.19147 WP_001295493.1.19148 WP_001295493.1.1915 WP_001295493.1.19150 WP_001295493.1.19153 WP_001295493.1.19171 WP_001295493.1.19194 WP_001295493.1.19205 WP_001295493.1.19206 WP_001295493.1.19245 WP_001295493.1.1925 WP_001295493.1.19276 WP_001295493.1.19277 WP_001295493.1.19297 WP_001295493.1.193 WP_001295493.1.19312 WP_001295493.1.19313 WP_001295493.1.19314 WP_001295493.1.19315 WP_001295493.1.19332 WP_001295493.1.19338 WP_001295493.1.19347 WP_001295493.1.19350 WP_001295493.1.19361 WP_001295493.1.19389 WP_001295493.1.19419 WP_001295493.1.19424 WP_001295493.1.19441 WP_001295493.1.19448 WP_001295493.1.19453 WP_001295493.1.19465 WP_001295493.1.19478 WP_001295493.1.19487 WP_001295493.1.19494 WP_001295493.1.1952 WP_001295493.1.19544 WP_001295493.1.19547 WP_001295493.1.19557 WP_001295493.1.19581 WP_001295493.1.19583 WP_001295493.1.19593 WP_001295493.1.1960 WP_001295493.1.19602 WP_001295493.1.1963 WP_001295493.1.19644 WP_001295493.1.19649 WP_001295493.1.19651 WP_001295493.1.19654 WP_001295493.1.19655 WP_001295493.1.19661 WP_001295493.1.19684 WP_001295493.1.19691 WP_001295493.1.19758 WP_001295493.1.19761 WP_001295493.1.19778 WP_001295493.1.19795 WP_001295493.1.1982 WP_001295493.1.19830 WP_001295493.1.19838 WP_001295493.1.19840 WP_001295493.1.19845 WP_001295493.1.19847 WP_001295493.1.19873 WP_001295493.1.19878 WP_001295493.1.19889 WP_001295493.1.19940 WP_001295493.1.19945 WP_001295493.1.19957 WP_001295493.1.19972 WP_001295493.1.20025 WP_001295493.1.2005 WP_001295493.1.20096 WP_001295493.1.20114 WP_001295493.1.20115 WP_001295493.1.20129 WP_001295493.1.20133 WP_001295493.1.20151 WP_001295493.1.20157 WP_001295493.1.20159 WP_001295493.1.20164 WP_001295493.1.20166 WP_001295493.1.20170 WP_001295493.1.20178 WP_001295493.1.20183 WP_001295493.1.20192 WP_001295493.1.20215 WP_001295493.1.2022 WP_001295493.1.20224 WP_001295493.1.20230 WP_001295493.1.20238 WP_001295493.1.20251 WP_001295493.1.20264 WP_001295493.1.20277 WP_001295493.1.20290 WP_001295493.1.20308 WP_001295493.1.20318 WP_001295493.1.20325 WP_001295493.1.20331 WP_001295493.1.20334 WP_001295493.1.20370 WP_001295493.1.20445 WP_001295493.1.20449 WP_001295493.1.20452 WP_001295493.1.20480 WP_001295493.1.20483 WP_001295493.1.20484 WP_001295493.1.20493 WP_001295493.1.20506 WP_001295493.1.20515 WP_001295493.1.20519 WP_001295493.1.20536 WP_001295493.1.20546 WP_001295493.1.20549 WP_001295493.1.20565 WP_001295493.1.20575 WP_001295493.1.20594 WP_001295493.1.20596 WP_001295493.1.20609 WP_001295493.1.2063 WP_001295493.1.20630 WP_001295493.1.20636 WP_001295493.1.20638 WP_001295493.1.20662 WP_001295493.1.20668 WP_001295493.1.20691 WP_001295493.1.20730 WP_001295493.1.20737 WP_001295493.1.20741 WP_001295493.1.20745 WP_001295493.1.2075 WP_001295493.1.20765 WP_001295493.1.20784 WP_001295493.1.20785 WP_001295493.1.20803 WP_001295493.1.20813 WP_001295493.1.20818 WP_001295493.1.20824 WP_001295493.1.20831 WP_001295493.1.20841 WP_001295493.1.20848 WP_001295493.1.2089 WP_001295493.1.20893 WP_001295493.1.20907 WP_001295493.1.2093 WP_001295493.1.2094 WP_001295493.1.20941 WP_001295493.1.20943 WP_001295493.1.20950 WP_001295493.1.20958 WP_001295493.1.20962 WP_001295493.1.20982 WP_001295493.1.20989 WP_001295493.1.2100 WP_001295493.1.21017 WP_001295493.1.21020 WP_001295493.1.21022 WP_001295493.1.21024 WP_001295493.1.21029 WP_001295493.1.21033 WP_001295493.1.21041 WP_001295493.1.21057 WP_001295493.1.21059 WP_001295493.1.21104 WP_001295493.1.21122 WP_001295493.1.21129 WP_001295493.1.2113 WP_001295493.1.21131 WP_001295493.1.21137 WP_001295493.1.21152 WP_001295493.1.21171 WP_001295493.1.21197 WP_001295493.1.21236 WP_001295493.1.21248 WP_001295493.1.21251 WP_001295493.1.21255 WP_001295493.1.21266 WP_001295493.1.21277 WP_001295493.1.21305 WP_001295493.1.21320 WP_001295493.1.21336 WP_001295493.1.21378 WP_001295493.1.2142 WP_001295493.1.21441 WP_001295493.1.21450 WP_001295493.1.21455 WP_001295493.1.21470 WP_001295493.1.21508 WP_001295493.1.21519 WP_001295493.1.21526 WP_001295493.1.21537 WP_001295493.1.2156 WP_001295493.1.21573 WP_001295493.1.21578 WP_001295493.1.21596 WP_001295493.1.21614 WP_001295493.1.21628 WP_001295493.1.21637 WP_001295493.1.2164 WP_001295493.1.21652 WP_001295493.1.21656 WP_001295493.1.21661 WP_001295493.1.21666 WP_001295493.1.21667 WP_001295493.1.21668 WP_001295493.1.21673 WP_001295493.1.21696 WP_001295493.1.21727 WP_001295493.1.21729 WP_001295493.1.21732 WP_001295493.1.21733 WP_001295493.1.21756 WP_001295493.1.21758 WP_001295493.1.21762 WP_001295493.1.21771 WP_001295493.1.21773 WP_001295493.1.21811 WP_001295493.1.21812 WP_001295493.1.21823 WP_001295493.1.21887 WP_001295493.1.21895 WP_001295493.1.21915 WP_001295493.1.21945 WP_001295493.1.21948 WP_001295493.1.21962 WP_001295493.1.2198 WP_001295493.1.21986 WP_001295493.1.21992 WP_001295493.1.22042 WP_001295493.1.22060 WP_001295493.1.22088 WP_001295493.1.22098 WP_001295493.1.22113 WP_001295493.1.22138 WP_001295493.1.22161 WP_001295493.1.2218 WP_001295493.1.22195 WP_001295493.1.22203 WP_001295493.1.22204 WP_001295493.1.22251 WP_001295493.1.22268 WP_001295493.1.22269 WP_001295493.1.22272 WP_001295493.1.22280 WP_001295493.1.22291 WP_001295493.1.22293 WP_001295493.1.22295 WP_001295493.1.22304 WP_001295493.1.22314 WP_001295493.1.2232 WP_001295493.1.22325 WP_001295493.1.22328 WP_001295493.1.22350 WP_001295493.1.22359 WP_001295493.1.22363 WP_001295493.1.22381 WP_001295493.1.22409 WP_001295493.1.2242 WP_001295493.1.22431 WP_001295493.1.22450 WP_001295493.1.22464 WP_001295493.1.22470 WP_001295493.1.22494 WP_001295493.1.22501 WP_001295493.1.22522 WP_001295493.1.22543 WP_001295493.1.22544 WP_001295493.1.22571 WP_001295493.1.22572 WP_001295493.1.22574 WP_001295493.1.22576 WP_001295493.1.22579 WP_001295493.1.22594 WP_001295493.1.22599 WP_001295493.1.22631 WP_001295493.1.22632 WP_001295493.1.22641 WP_001295493.1.22649 WP_001295493.1.22662 WP_001295493.1.22667 WP_001295493.1.22669 WP_001295493.1.22685 WP_001295493.1.22690 WP_001295493.1.22691 WP_001295493.1.22743 WP_001295493.1.22756 WP_001295493.1.22765 WP_001295493.1.22771 WP_001295493.1.22777 WP_001295493.1.22783 WP_001295493.1.22809 WP_001295493.1.22814 WP_001295493.1.22824 WP_001295493.1.22827 WP_001295493.1.22830 WP_001295493.1.22868 WP_001295493.1.22875 WP_001295493.1.22878 WP_001295493.1.22885 WP_001295493.1.22896 WP_001295493.1.22908 WP_001295493.1.22917 WP_001295493.1.22925 WP_001295493.1.22961 WP_001295493.1.22988 WP_001295493.1.22990 WP_001295493.1.22993 WP_001295493.1.2300 WP_001295493.1.23005 WP_001295493.1.23026 WP_001295493.1.23035 WP_001295493.1.23044 WP_001295493.1.23045 WP_001295493.1.23057 WP_001295493.1.23062 WP_001295493.1.23073 WP_001295493.1.23078 WP_001295493.1.23081 WP_001295493.1.23090 WP_001295493.1.23092 WP_001295493.1.23105 WP_001295493.1.23109 WP_001295493.1.23115 WP_001295493.1.23120 WP_001295493.1.23135 WP_001295493.1.2322 WP_001295493.1.23241 WP_001295493.1.2325 WP_001295493.1.23257 WP_001295493.1.23270 WP_001295493.1.23282 WP_001295493.1.23285 WP_001295493.1.23290 WP_001295493.1.23293 WP_001295493.1.23299 WP_001295493.1.23323 WP_001295493.1.23330 WP_001295493.1.23351 WP_001295493.1.23352 WP_001295493.1.23355 WP_001295493.1.23376 WP_001295493.1.23378 WP_001295493.1.23383 WP_001295493.1.23393 WP_001295493.1.23443 WP_001295493.1.23456 WP_001295493.1.23463 WP_001295493.1.23467 WP_001295493.1.23486 WP_001295493.1.23487 WP_001295493.1.23511 WP_001295493.1.23520 WP_001295493.1.23522 WP_001295493.1.23527 WP_001295493.1.2353 WP_001295493.1.23549 WP_001295493.1.23554 WP_001295493.1.23561 WP_001295493.1.23563 WP_001295493.1.23584 WP_001295493.1.23593 WP_001295493.1.2362 WP_001295493.1.23622 WP_001295493.1.23640 WP_001295493.1.23660 WP_001295493.1.23676 WP_001295493.1.23693 WP_001295493.1.23700 WP_001295493.1.23711 WP_001295493.1.23724 WP_001295493.1.23729 WP_001295493.1.23741 WP_001295493.1.23752 WP_001295493.1.23754 WP_001295493.1.23765 WP_001295493.1.23790 WP_001295493.1.23795 WP_001295493.1.23806 WP_001295493.1.23812 WP_001295493.1.23838 WP_001295493.1.23840 WP_001295493.1.23855 WP_001295493.1.23869 WP_001295493.1.2388 WP_001295493.1.23881 WP_001295493.1.23886 WP_001295493.1.23890 WP_001295493.1.23895 WP_001295493.1.23898 WP_001295493.1.23899 WP_001295493.1.23914 WP_001295493.1.23915 WP_001295493.1.23931 WP_001295493.1.23945 WP_001295493.1.2395 WP_001295493.1.23950 WP_001295493.1.23953 WP_001295493.1.23960 WP_001295493.1.23970 WP_001295493.1.23971 WP_001295493.1.23973 WP_001295493.1.23984 WP_001295493.1.23985 WP_001295493.1.24 WP_001295493.1.24024 WP_001295493.1.24038 WP_001295493.1.24045 WP_001295493.1.24051 WP_001295493.1.24058 WP_001295493.1.24068 WP_001295493.1.24070 WP_001295493.1.24088 WP_001295493.1.24089 WP_001295493.1.24120 WP_001295493.1.24122 WP_001295493.1.24124 WP_001295493.1.24127 WP_001295493.1.2413 WP_001295493.1.24136 WP_001295493.1.24177 WP_001295493.1.2418 WP_001295493.1.24194 WP_001295493.1.24233 WP_001295493.1.24278 WP_001295493.1.2428 WP_001295493.1.24283 WP_001295493.1.24290 WP_001295493.1.2430 WP_001295493.1.24304 WP_001295493.1.24316 WP_001295493.1.2433 WP_001295493.1.24341 WP_001295493.1.24362 WP_001295493.1.2437 WP_001295493.1.24374 WP_001295493.1.24381 WP_001295493.1.24383 WP_001295493.1.24458 WP_001295493.1.24460 WP_001295493.1.24473 WP_001295493.1.24483 WP_001295493.1.24485 WP_001295493.1.2449 WP_001295493.1.24499 WP_001295493.1.24533 WP_001295493.1.24536 WP_001295493.1.24547 WP_001295493.1.2456 WP_001295493.1.24560 WP_001295493.1.24570 WP_001295493.1.24575 WP_001295493.1.24577 WP_001295493.1.24583 WP_001295493.1.24592 WP_001295493.1.24616 WP_001295493.1.24634 WP_001295493.1.24641 WP_001295493.1.24642 WP_001295493.1.24646 WP_001295493.1.24650 WP_001295493.1.2469 WP_001295493.1.24693 WP_001295493.1.24695 WP_001295493.1.24703 WP_001295493.1.24752 WP_001295493.1.24753 WP_001295493.1.24763 WP_001295493.1.24773 WP_001295493.1.24783 WP_001295493.1.2479 WP_001295493.1.24791 WP_001295493.1.24797 WP_001295493.1.24799 WP_001295493.1.24849 WP_001295493.1.24854 WP_001295493.1.24870 WP_001295493.1.24876 WP_001295493.1.24899 WP_001295493.1.24906 WP_001295493.1.24909 WP_001295493.1.24926 WP_001295493.1.24929 WP_001295493.1.24939 WP_001295493.1.24946 WP_001295493.1.24960 WP_001295493.1.24968 WP_001295493.1.24979 WP_001295493.1.24981 WP_001295493.1.24982 WP_001295493.1.24984 WP_001295493.1.25019 WP_001295493.1.25038 WP_001295493.1.25039 WP_001295493.1.2504 WP_001295493.1.25042 WP_001295493.1.25050 WP_001295493.1.25060 WP_001295493.1.25076 WP_001295493.1.25082 WP_001295493.1.25086 WP_001295493.1.25087 WP_001295493.1.25088 WP_001295493.1.2512 WP_001295493.1.25126 WP_001295493.1.25141 WP_001295493.1.25201 WP_001295493.1.25203 WP_001295493.1.25204 WP_001295493.1.25248 WP_001295493.1.25272 WP_001295493.1.25289 WP_001295493.1.25305 WP_001295493.1.2531 WP_001295493.1.25312 WP_001295493.1.25324 WP_001295493.1.25346 WP_001295493.1.2537 WP_001295493.1.25372 WP_001295493.1.25378 WP_001295493.1.25380 WP_001295493.1.254 WP_001295493.1.25403 WP_001295493.1.25414 WP_001295493.1.25420 WP_001295493.1.2543 WP_001295493.1.25446 WP_001295493.1.25480 WP_001295493.1.255 WP_001295493.1.25517 WP_001295493.1.25525 WP_001295493.1.25526 WP_001295493.1.25548 WP_001295493.1.25577 WP_001295493.1.2558 WP_001295493.1.25592 WP_001295493.1.25598 WP_001295493.1.25602 WP_001295493.1.25612 WP_001295493.1.25613 WP_001295493.1.25631 WP_001295493.1.25643 WP_001295493.1.25652 WP_001295493.1.2567 WP_001295493.1.25680 WP_001295493.1.25681 WP_001295493.1.25701 WP_001295493.1.25713 WP_001295493.1.25717 WP_001295493.1.25718 WP_001295493.1.25724 WP_001295493.1.25726 WP_001295493.1.25750 WP_001295493.1.25753 WP_001295493.1.25755 WP_001295493.1.25794 WP_001295493.1.25799 WP_001295493.1.25819 WP_001295493.1.25831 WP_001295493.1.25832 WP_001295493.1.25843 WP_001295493.1.25855 WP_001295493.1.25869 WP_001295493.1.25873 WP_001295493.1.25886 WP_001295493.1.2589 WP_001295493.1.25890 WP_001295493.1.25895 WP_001295493.1.25915 WP_001295493.1.25945 WP_001295493.1.2597 WP_001295493.1.25996 WP_001295493.1.26005 WP_001295493.1.26048 WP_001295493.1.26055 WP_001295493.1.26061 WP_001295493.1.26066 WP_001295493.1.26076 WP_001295493.1.26100 WP_001295493.1.26105 WP_001295493.1.2612 WP_001295493.1.26121 WP_001295493.1.26125 WP_001295493.1.26130 WP_001295493.1.26131 WP_001295493.1.26134 WP_001295493.1.26135 WP_001295493.1.26150 WP_001295493.1.26161 WP_001295493.1.26175 WP_001295493.1.26186 WP_001295493.1.26189 WP_001295493.1.26191 WP_001295493.1.26196 WP_001295493.1.26246 WP_001295493.1.26259 WP_001295493.1.26262 WP_001295493.1.26270 WP_001295493.1.26284 WP_001295493.1.26304 WP_001295493.1.26325 WP_001295493.1.2637 WP_001295493.1.26379 WP_001295493.1.26391 WP_001295493.1.26398 WP_001295493.1.26401 WP_001295493.1.26403 WP_001295493.1.2642 WP_001295493.1.26438 WP_001295493.1.26467 WP_001295493.1.26474 WP_001295493.1.26479 WP_001295493.1.26480 WP_001295493.1.26517 WP_001295493.1.26525 WP_001295493.1.26569 WP_001295493.1.26570 WP_001295493.1.26575 WP_001295493.1.26579 WP_001295493.1.26588 WP_001295493.1.26590 WP_001295493.1.26598 WP_001295493.1.26609 WP_001295493.1.26613 WP_001295493.1.26644 WP_001295493.1.26658 WP_001295493.1.26683 WP_001295493.1.26716 WP_001295493.1.26720 WP_001295493.1.26736 WP_001295493.1.26761 WP_001295493.1.26766 WP_001295493.1.26837 WP_001295493.1.26839 WP_001295493.1.26861 WP_001295493.1.26912 WP_001295493.1.26941 WP_001295493.1.26943 WP_001295493.1.2695 WP_001295493.1.26950 WP_001295493.1.26975 WP_001295493.1.26987 WP_001295493.1.26995 WP_001295493.1.26998 WP_001295493.1.2700 WP_001295493.1.27019 WP_001295493.1.27043 WP_001295493.1.27057 WP_001295493.1.27060 WP_001295493.1.27091 WP_001295493.1.27098 WP_001295493.1.27101 WP_001295493.1.27105 WP_001295493.1.2712 WP_001295493.1.27134 WP_001295493.1.27141 WP_001295493.1.27148 WP_001295493.1.27175 WP_001295493.1.27188 WP_001295493.1.27214 WP_001295493.1.27234 WP_001295493.1.27260 WP_001295493.1.27280 WP_001295493.1.27283 WP_001295493.1.27287 WP_001295493.1.27292 WP_001295493.1.2731 WP_001295493.1.27310 WP_001295493.1.27330 WP_001295493.1.27338 WP_001295493.1.27367 WP_001295493.1.27373 WP_001295493.1.27396 WP_001295493.1.27401 WP_001295493.1.27424 WP_001295493.1.27426 WP_001295493.1.27445 WP_001295493.1.2745 WP_001295493.1.27451 WP_001295493.1.27472 WP_001295493.1.27504 WP_001295493.1.27518 WP_001295493.1.27520 WP_001295493.1.27524 WP_001295493.1.2755 WP_001295493.1.27560 WP_001295493.1.27580 WP_001295493.1.27618 WP_001295493.1.27683 WP_001295493.1.27691 WP_001295493.1.27693 WP_001295493.1.27698 WP_001295493.1.27723 WP_001295493.1.27741 WP_001295493.1.27742 WP_001295493.1.27749 WP_001295493.1.27758 WP_001295493.1.27774 WP_001295493.1.27786 WP_001295493.1.27846 WP_001295493.1.27856 WP_001295493.1.27861 WP_001295493.1.27871 WP_001295493.1.27876 WP_001295493.1.27879 WP_001295493.1.27897 WP_001295493.1.27913 WP_001295493.1.27923 WP_001295493.1.27957 WP_001295493.1.27971 WP_001295493.1.27998 WP_001295493.1.28026 WP_001295493.1.28046 WP_001295493.1.28102 WP_001295493.1.28109 WP_001295493.1.2811 WP_001295493.1.28110 WP_001295493.1.28128 WP_001295493.1.28143 WP_001295493.1.28145 WP_001295493.1.28156 WP_001295493.1.28167 WP_001295493.1.28168 WP_001295493.1.28184 WP_001295493.1.28199 WP_001295493.1.2823 WP_001295493.1.28250 WP_001295493.1.2826 WP_001295493.1.28268 WP_001295493.1.28271 WP_001295493.1.28314 WP_001295493.1.28318 WP_001295493.1.28322 WP_001295493.1.28345 WP_001295493.1.28349 WP_001295493.1.28371 WP_001295493.1.28401 WP_001295493.1.28414 WP_001295493.1.28433 WP_001295493.1.28440 WP_001295493.1.28461 WP_001295493.1.28476 WP_001295493.1.28480 WP_001295493.1.28491 WP_001295493.1.28496 WP_001295493.1.28500 WP_001295493.1.28509 WP_001295493.1.28523 WP_001295493.1.28536 WP_001295493.1.28540 WP_001295493.1.28544 WP_001295493.1.28551 WP_001295493.1.28554 WP_001295493.1.28568 WP_001295493.1.28639 WP_001295493.1.28662 WP_001295493.1.28683 WP_001295493.1.28697 WP_001295493.1.28723 WP_001295493.1.28732 WP_001295493.1.28734 WP_001295493.1.28736 WP_001295493.1.28742 WP_001295493.1.28760 WP_001295493.1.28762 WP_001295493.1.28769 WP_001295493.1.28791 WP_001295493.1.28809 WP_001295493.1.2881 WP_001295493.1.28829 WP_001295493.1.28835 WP_001295493.1.28863 WP_001295493.1.28879 WP_001295493.1.28919 WP_001295493.1.28924 WP_001295493.1.28953 WP_001295493.1.28982 WP_001295493.1.28994 WP_001295493.1.290 WP_001295493.1.29001 WP_001295493.1.29013 WP_001295493.1.29016 WP_001295493.1.29026 WP_001295493.1.29049 WP_001295493.1.29055 WP_001295493.1.29061 WP_001295493.1.29079 WP_001295493.1.29082 WP_001295493.1.291 WP_001295493.1.29100 WP_001295493.1.29118 WP_001295493.1.29125 WP_001295493.1.29126 WP_001295493.1.29128 WP_001295493.1.29146 WP_001295493.1.29150 WP_001295493.1.29164 WP_001295493.1.29176 WP_001295493.1.29194 WP_001295493.1.29197 WP_001295493.1.29206 WP_001295493.1.29221 WP_001295493.1.29230 WP_001295493.1.29239 WP_001295493.1.29252 WP_001295493.1.29258 WP_001295493.1.2926 WP_001295493.1.2931 WP_001295493.1.29341 WP_001295493.1.29394 WP_001295493.1.29404 WP_001295493.1.2942 WP_001295493.1.29429 WP_001295493.1.2945 WP_001295493.1.29486 WP_001295493.1.29495 WP_001295493.1.29497 WP_001295493.1.29503 WP_001295493.1.29504 WP_001295493.1.2952 WP_001295493.1.2954 WP_001295493.1.29556 WP_001295493.1.29564 WP_001295493.1.29590 WP_001295493.1.29597 WP_001295493.1.29603 WP_001295493.1.29618 WP_001295493.1.2963 WP_001295493.1.29643 WP_001295493.1.29647 WP_001295493.1.29662 WP_001295493.1.29669 WP_001295493.1.29683 WP_001295493.1.29689 WP_001295493.1.29699 WP_001295493.1.29715 WP_001295493.1.29740 WP_001295493.1.29746 WP_001295493.1.29752 WP_001295493.1.2978 WP_001295493.1.29798 WP_001295493.1.29812 WP_001295493.1.29815 WP_001295493.1.29818 WP_001295493.1.29819 WP_001295493.1.29840 WP_001295493.1.29855 WP_001295493.1.2986 WP_001295493.1.29874 WP_001295493.1.29876 WP_001295493.1.29933 WP_001295493.1.2995 WP_001295493.1.29967 WP_001295493.1.29976 WP_001295493.1.29988 WP_001295493.1.29992 WP_001295493.1.30 WP_001295493.1.30004 WP_001295493.1.30019 WP_001295493.1.30035 WP_001295493.1.30052 WP_001295493.1.30063 WP_001295493.1.30064 WP_001295493.1.30098 WP_001295493.1.30105 WP_001295493.1.30123 WP_001295493.1.30141 WP_001295493.1.30164 WP_001295493.1.3018 WP_001295493.1.30221 WP_001295493.1.30231 WP_001295493.1.30232 WP_001295493.1.30239 WP_001295493.1.30247 WP_001295493.1.30253 WP_001295493.1.30298 WP_001295493.1.30347 WP_001295493.1.30391 WP_001295493.1.30397 WP_001295493.1.30399 WP_001295493.1.30400 WP_001295493.1.30401 WP_001295493.1.30428 WP_001295493.1.30447 WP_001295493.1.3045 WP_001295493.1.30452 WP_001295493.1.30472 WP_001295493.1.30476 WP_001295493.1.30479 WP_001295493.1.30497 WP_001295493.1.30524 WP_001295493.1.30546 WP_001295493.1.3055 WP_001295493.1.30550 WP_001295493.1.30554 WP_001295493.1.30580 WP_001295493.1.306 WP_001295493.1.3063 WP_001295493.1.30630 WP_001295493.1.30637 WP_001295493.1.30639 WP_001295493.1.30640 WP_001295493.1.30658 WP_001295493.1.30665 WP_001295493.1.30691 WP_001295493.1.30700 WP_001295493.1.30733 WP_001295493.1.30742 WP_001295493.1.30749 WP_001295493.1.30783 WP_001295493.1.30808 WP_001295493.1.30843 WP_001295493.1.30853 WP_001295493.1.30866 WP_001295493.1.30867 WP_001295493.1.30879 WP_001295493.1.30887 WP_001295493.1.309 WP_001295493.1.30906 WP_001295493.1.30918 WP_001295493.1.30960 WP_001295493.1.30993 WP_001295493.1.30999 WP_001295493.1.31000 WP_001295493.1.31009 WP_001295493.1.31017 WP_001295493.1.31026 WP_001295493.1.31029 WP_001295493.1.31055 WP_001295493.1.31089 WP_001295493.1.31119 WP_001295493.1.31129 WP_001295493.1.31149 WP_001295493.1.31154 WP_001295493.1.31188 WP_001295493.1.312 WP_001295493.1.31211 WP_001295493.1.31252 WP_001295493.1.31295 WP_001295493.1.31319 WP_001295493.1.31340 WP_001295493.1.31347 WP_001295493.1.31353 WP_001295493.1.31357 WP_001295493.1.31379 WP_001295493.1.3140 WP_001295493.1.31401 WP_001295493.1.31407 WP_001295493.1.31419 WP_001295493.1.31421 WP_001295493.1.31422 WP_001295493.1.31429 WP_001295493.1.31431 WP_001295493.1.31433 WP_001295493.1.31434 WP_001295493.1.3147 WP_001295493.1.31482 WP_001295493.1.31506 WP_001295493.1.31511 WP_001295493.1.31518 WP_001295493.1.31521 WP_001295493.1.31527 WP_001295493.1.31542 WP_001295493.1.31557 WP_001295493.1.31575 WP_001295493.1.31596 WP_001295493.1.31614 WP_001295493.1.31625 WP_001295493.1.31639 WP_001295493.1.31657 WP_001295493.1.31675 WP_001295493.1.31679 WP_001295493.1.31681 WP_001295493.1.3169 WP_001295493.1.31696 WP_001295493.1.31709 WP_001295493.1.31715 WP_001295493.1.31736 WP_001295493.1.31740 WP_001295493.1.3176 WP_001295493.1.31801 WP_001295493.1.31803 WP_001295493.1.31809 WP_001295493.1.3181 WP_001295493.1.31833 WP_001295493.1.31835 WP_001295493.1.31860 WP_001295493.1.31866 WP_001295493.1.31898 WP_001295493.1.31899 WP_001295493.1.31903 WP_001295493.1.31924 WP_001295493.1.31928 WP_001295493.1.3193 WP_001295493.1.31937 WP_001295493.1.31956 WP_001295493.1.31978 WP_001295493.1.3201 WP_001295493.1.32020 WP_001295493.1.32021 WP_001295493.1.32024 WP_001295493.1.3203 WP_001295493.1.32030 WP_001295493.1.32037 WP_001295493.1.32049 WP_001295493.1.32063 WP_001295493.1.32078 WP_001295493.1.32091 WP_001295493.1.32093 WP_001295493.1.3212 WP_001295493.1.32121 WP_001295493.1.32127 WP_001295493.1.32138 WP_001295493.1.32142 WP_001295493.1.32143 WP_001295493.1.3215 WP_001295493.1.32173 WP_001295493.1.32184 WP_001295493.1.322 WP_001295493.1.32232 WP_001295493.1.32234 WP_001295493.1.32242 WP_001295493.1.32243 WP_001295493.1.32279 WP_001295493.1.32287 WP_001295493.1.3233 WP_001295493.1.32333 WP_001295493.1.32406 WP_001295493.1.32432 WP_001295493.1.32435 WP_001295493.1.32443 WP_001295493.1.32448 WP_001295493.1.3247 WP_001295493.1.32475 WP_001295493.1.32478 WP_001295493.1.32479 WP_001295493.1.3248 WP_001295493.1.32480 WP_001295493.1.32494 WP_001295493.1.32509 WP_001295493.1.32518 WP_001295493.1.32536 WP_001295493.1.32558 WP_001295493.1.32561 WP_001295493.1.32574 WP_001295493.1.32587 WP_001295493.1.3259 WP_001295493.1.32590 WP_001295493.1.32591 WP_001295493.1.32601 WP_001295493.1.32635 WP_001295493.1.32650 WP_001295493.1.32655 WP_001295493.1.32661 WP_001295493.1.32680 WP_001295493.1.3269 WP_001295493.1.327 WP_001295493.1.32709 WP_001295493.1.32715 WP_001295493.1.32720 WP_001295493.1.32724 WP_001295493.1.32741 WP_001295493.1.32748 WP_001295493.1.32772 WP_001295493.1.32811 WP_001295493.1.32815 WP_001295493.1.32831 WP_001295493.1.32835 WP_001295493.1.32875 WP_001295493.1.32888 WP_001295493.1.32903 WP_001295493.1.32910 WP_001295493.1.32931 WP_001295493.1.32938 WP_001295493.1.32946 WP_001295493.1.3295 WP_001295493.1.32959 WP_001295493.1.32972 WP_001295493.1.32984 WP_001295493.1.32992 WP_001295493.1.32995 WP_001295493.1.33004 WP_001295493.1.33014 WP_001295493.1.33018 WP_001295493.1.33022 WP_001295493.1.33026 WP_001295493.1.33046 WP_001295493.1.33049 WP_001295493.1.33053 WP_001295493.1.33055 WP_001295493.1.33094 WP_001295493.1.33101 WP_001295493.1.33119 WP_001295493.1.33125 WP_001295493.1.33146 WP_001295493.1.33167 WP_001295493.1.33171 WP_001295493.1.33178 WP_001295493.1.33179 WP_001295493.1.33222 WP_001295493.1.3323 WP_001295493.1.33237 WP_001295493.1.33238 WP_001295493.1.33268 WP_001295493.1.33303 WP_001295493.1.33325 WP_001295493.1.33341 WP_001295493.1.33352 WP_001295493.1.33362 WP_001295493.1.33369 WP_001295493.1.33385 WP_001295493.1.334 WP_001295493.1.33408 WP_001295493.1.33413 WP_001295493.1.33422 WP_001295493.1.33424 WP_001295493.1.3344 WP_001295493.1.33475 WP_001295493.1.33476 WP_001295493.1.33502 WP_001295493.1.33512 WP_001295493.1.33526 WP_001295493.1.3354 WP_001295493.1.33545 WP_001295493.1.33561 WP_001295493.1.33565 WP_001295493.1.33595 WP_001295493.1.33631 WP_001295493.1.33638 WP_001295493.1.33648 WP_001295493.1.33667 WP_001295493.1.33680 WP_001295493.1.33729 WP_001295493.1.33736 WP_001295493.1.33745 WP_001295493.1.33746 WP_001295493.1.33751 WP_001295493.1.33780 WP_001295493.1.33799 WP_001295493.1.33823 WP_001295493.1.33853 WP_001295493.1.33854 WP_001295493.1.33879 WP_001295493.1.33888 WP_001295493.1.33914 WP_001295493.1.33948 WP_001295493.1.33952 WP_001295493.1.33973 WP_001295493.1.33974 WP_001295493.1.33979 WP_001295493.1.3398 WP_001295493.1.33981 WP_001295493.1.34003 WP_001295493.1.3401 WP_001295493.1.34032 WP_001295493.1.3411 WP_001295493.1.34121 WP_001295493.1.34122 WP_001295493.1.34124 WP_001295493.1.34130 WP_001295493.1.34144 WP_001295493.1.3415 WP_001295493.1.342 WP_001295493.1.34206 WP_001295493.1.34208 WP_001295493.1.34224 WP_001295493.1.34269 WP_001295493.1.34270 WP_001295493.1.34273 WP_001295493.1.34277 WP_001295493.1.34332 WP_001295493.1.34341 WP_001295493.1.34348 WP_001295493.1.34362 WP_001295493.1.34363 WP_001295493.1.34380 WP_001295493.1.34383 WP_001295493.1.3439 WP_001295493.1.34397 WP_001295493.1.34400 WP_001295493.1.34422 WP_001295493.1.3444 WP_001295493.1.34440 WP_001295493.1.34441 WP_001295493.1.34444 WP_001295493.1.34464 WP_001295493.1.34500 WP_001295493.1.34525 WP_001295493.1.34528 WP_001295493.1.34532 WP_001295493.1.34538 WP_001295493.1.34541 WP_001295493.1.34557 WP_001295493.1.34558 WP_001295493.1.3460 WP_001295493.1.34605 WP_001295493.1.34617 WP_001295493.1.34655 WP_001295493.1.34668 WP_001295493.1.34675 WP_001295493.1.34680 WP_001295493.1.34682 WP_001295493.1.34683 WP_001295493.1.34686 WP_001295493.1.3469 WP_001295493.1.347 WP_001295493.1.3472 WP_001295493.1.34727 WP_001295493.1.34763 WP_001295493.1.34781 WP_001295493.1.34782 WP_001295493.1.34794 WP_001295493.1.34827 WP_001295493.1.34838 WP_001295493.1.34855 WP_001295493.1.34875 WP_001295493.1.34887 WP_001295493.1.34931 WP_001295493.1.34948 WP_001295493.1.34966 WP_001295493.1.34982 WP_001295493.1.34983 WP_001295493.1.34990 WP_001295493.1.34993 WP_001295493.1.35003 WP_001295493.1.35006 WP_001295493.1.35007 WP_001295493.1.35039 WP_001295493.1.35107 WP_001295493.1.35114 WP_001295493.1.35132 WP_001295493.1.3515 WP_001295493.1.35168 WP_001295493.1.35180 WP_001295493.1.35186 WP_001295493.1.35195 WP_001295493.1.35198 WP_001295493.1.35202 WP_001295493.1.35204 WP_001295493.1.35208 WP_001295493.1.3521 WP_001295493.1.35211 WP_001295493.1.35220 WP_001295493.1.35258 WP_001295493.1.35316 WP_001295493.1.35328 WP_001295493.1.35349 WP_001295493.1.35360 WP_001295493.1.35365 WP_001295493.1.35368 WP_001295493.1.35376 WP_001295493.1.3539 WP_001295493.1.35393 WP_001295493.1.35394 WP_001295493.1.35398 WP_001295493.1.35448 WP_001295493.1.35464 WP_001295493.1.35465 WP_001295493.1.35466 WP_001295493.1.35468 WP_001295493.1.3550 WP_001295493.1.35552 WP_001295493.1.35578 WP_001295493.1.35581 WP_001295493.1.3560 WP_001295493.1.35604 WP_001295493.1.35627 WP_001295493.1.35632 WP_001295493.1.35649 WP_001295493.1.35651 WP_001295493.1.35653 WP_001295493.1.35654 WP_001295493.1.35698 WP_001295493.1.35704 WP_001295493.1.35724 WP_001295493.1.35740 WP_001295493.1.35741 WP_001295493.1.35889 WP_001295493.1.35904 WP_001295493.1.35922 WP_001295493.1.35927 WP_001295493.1.35934 WP_001295493.1.35942 WP_001295493.1.35959 WP_001295493.1.35963 WP_001295493.1.3598 WP_001295493.1.35983 WP_001295493.1.35987 WP_001295493.1.35990 WP_001295493.1.36010 WP_001295493.1.36040 WP_001295493.1.36042 WP_001295493.1.36070 WP_001295493.1.36071 WP_001295493.1.36085 WP_001295493.1.36094 WP_001295493.1.36105 WP_001295493.1.36129 WP_001295493.1.36159 WP_001295493.1.36164 WP_001295493.1.36166 WP_001295493.1.36177 WP_001295493.1.36182 WP_001295493.1.3620 WP_001295493.1.36207 WP_001295493.1.36212 WP_001295493.1.36281 WP_001295493.1.36299 WP_001295493.1.36332 WP_001295493.1.36334 WP_001295493.1.36352 WP_001295493.1.36386 WP_001295493.1.36393 WP_001295493.1.36405 WP_001295493.1.36412 WP_001295493.1.36426 WP_001295493.1.3643 WP_001295493.1.36453 WP_001295493.1.36459 WP_001295493.1.36500 WP_001295493.1.36507 WP_001295493.1.36523 WP_001295493.1.36531 WP_001295493.1.36537 WP_001295493.1.36610 WP_001295493.1.36626 WP_001295493.1.36627 WP_001295493.1.36628 WP_001295493.1.36667 WP_001295493.1.3668 WP_001295493.1.36699 WP_001295493.1.36707 WP_001295493.1.3671 WP_001295493.1.36724 WP_001295493.1.36739 WP_001295493.1.36746 WP_001295493.1.36747 WP_001295493.1.36761 WP_001295493.1.36767 WP_001295493.1.36812 WP_001295493.1.36817 WP_001295493.1.36826 WP_001295493.1.36833 WP_001295493.1.36856 WP_001295493.1.36886 WP_001295493.1.36904 WP_001295493.1.36925 WP_001295493.1.3697 WP_001295493.1.36971 WP_001295493.1.36975 WP_001295493.1.37006 WP_001295493.1.37020 WP_001295493.1.37032 WP_001295493.1.37046 WP_001295493.1.37049 WP_001295493.1.37057 WP_001295493.1.37076 WP_001295493.1.37101 WP_001295493.1.37102 WP_001295493.1.37103 WP_001295493.1.37122 WP_001295493.1.37146 WP_001295493.1.37153 WP_001295493.1.37155 WP_001295493.1.37206 WP_001295493.1.37226 WP_001295493.1.3723 WP_001295493.1.37233 WP_001295493.1.37252 WP_001295493.1.37261 WP_001295493.1.37266 WP_001295493.1.37290 WP_001295493.1.3730 WP_001295493.1.37306 WP_001295493.1.37329 WP_001295493.1.37334 WP_001295493.1.37337 WP_001295493.1.37342 WP_001295493.1.37352 WP_001295493.1.37371 WP_001295493.1.37372 WP_001295493.1.37388 WP_001295493.1.37419 WP_001295493.1.37423 WP_001295493.1.37433 WP_001295493.1.37445 WP_001295493.1.37472 WP_001295493.1.37476 WP_001295493.1.37477 WP_001295493.1.37485 WP_001295493.1.3749 WP_001295493.1.37510 WP_001295493.1.37516 WP_001295493.1.37538 WP_001295493.1.37543 WP_001295493.1.37544 WP_001295493.1.37548 WP_001295493.1.37549 WP_001295493.1.37550 WP_001295493.1.37554 WP_001295493.1.37576 WP_001295493.1.37588 WP_001295493.1.37608 WP_001295493.1.3762 WP_001295493.1.37634 WP_001295493.1.37637 WP_001295493.1.377 WP_001295493.1.3772 WP_001295493.1.37730 WP_001295493.1.37731 WP_001295493.1.37745 WP_001295493.1.37750 WP_001295493.1.37758 WP_001295493.1.37762 WP_001295493.1.37766 WP_001295493.1.37769 WP_001295493.1.37773 WP_001295493.1.37817 WP_001295493.1.37830 WP_001295493.1.37847 WP_001295493.1.37852 WP_001295493.1.37853 WP_001295493.1.3788 WP_001295493.1.37880 WP_001295493.1.37887 WP_001295493.1.37897 WP_001295493.1.37917 WP_001295493.1.37923 WP_001295493.1.37926 WP_001295493.1.37940 WP_001295493.1.3795 WP_001295493.1.3796 WP_001295493.1.37962 WP_001295493.1.37964 WP_001295493.1.37967 WP_001295493.1.37984 WP_001295493.1.37995 WP_001295493.1.37998 WP_001295493.1.38000 WP_001295493.1.38033 WP_001295493.1.38043 WP_001295493.1.38050 WP_001295493.1.38063 WP_001295493.1.38080 WP_001295493.1.38081 WP_001295493.1.38085 WP_001295493.1.38103 WP_001295493.1.38105 WP_001295493.1.38107 WP_001295493.1.3811 WP_001295493.1.38119 WP_001295493.1.38120 WP_001295493.1.3815 WP_001295493.1.38162 WP_001295493.1.38182 WP_001295493.1.38185 WP_001295493.1.38202 WP_001295493.1.38211 WP_001295493.1.3822 WP_001295493.1.38257 WP_001295493.1.38264 WP_001295493.1.38300 WP_001295493.1.38306 WP_001295493.1.38314 WP_001295493.1.38323 WP_001295493.1.38357 WP_001295493.1.38363 WP_001295493.1.38369 WP_001295493.1.38371 WP_001295493.1.38392 WP_001295493.1.38412 WP_001295493.1.38419 WP_001295493.1.38485 WP_001295493.1.38533 WP_001295493.1.38544 WP_001295493.1.38561 WP_001295493.1.38567 WP_001295493.1.38584 WP_001295493.1.38610 WP_001295493.1.38626 WP_001295493.1.38629 WP_001295493.1.38636 WP_001295493.1.38694 WP_001295493.1.38722 WP_001295493.1.3873 WP_001295493.1.38751 WP_001295493.1.38777 WP_001295493.1.38782 WP_001295493.1.38827 WP_001295493.1.38835 WP_001295493.1.38843 WP_001295493.1.38896 WP_001295493.1.389 WP_001295493.1.38911 WP_001295493.1.38920 WP_001295493.1.38935 WP_001295493.1.38937 WP_001295493.1.38950 WP_001295493.1.38956 WP_001295493.1.38958 WP_001295493.1.39005 WP_001295493.1.39015 WP_001295493.1.3903 WP_001295493.1.39037 WP_001295493.1.3904 WP_001295493.1.39042 WP_001295493.1.39063 WP_001295493.1.39103 WP_001295493.1.39111 WP_001295493.1.3912 WP_001295493.1.39123 WP_001295493.1.39148 WP_001295493.1.39150 WP_001295493.1.39155 WP_001295493.1.39157 WP_001295493.1.39164 WP_001295493.1.39167 WP_001295493.1.39171 WP_001295493.1.39180 WP_001295493.1.39184 WP_001295493.1.39209 WP_001295493.1.3921 WP_001295493.1.3922 WP_001295493.1.39232 WP_001295493.1.39249 WP_001295493.1.39268 WP_001295493.1.39286 WP_001295493.1.39289 WP_001295493.1.39302 WP_001295493.1.39305 WP_001295493.1.39310 WP_001295493.1.39313 WP_001295493.1.39325 WP_001295493.1.39335 WP_001295493.1.39342 WP_001295493.1.39356 WP_001295493.1.39358 WP_001295493.1.39365 WP_001295493.1.39367 WP_001295493.1.39373 WP_001295493.1.39377 WP_001295493.1.39401 WP_001295493.1.39402 WP_001295493.1.39415 WP_001295493.1.39423 WP_001295493.1.39430 WP_001295493.1.39468 WP_001295493.1.39481 WP_001295493.1.39492 WP_001295493.1.39509 WP_001295493.1.39531 WP_001295493.1.3954 WP_001295493.1.39541 WP_001295493.1.39564 WP_001295493.1.39575 WP_001295493.1.39580 WP_001295493.1.39594 WP_001295493.1.39601 WP_001295493.1.39606 WP_001295493.1.39607 WP_001295493.1.39610 WP_001295493.1.39626 WP_001295493.1.39636 WP_001295493.1.39646 WP_001295493.1.39651 WP_001295493.1.39690 WP_001295493.1.3970 WP_001295493.1.39708 WP_001295493.1.39709 WP_001295493.1.39713 WP_001295493.1.39715 WP_001295493.1.39717 WP_001295493.1.39730 WP_001295493.1.39733 WP_001295493.1.39734 WP_001295493.1.39758 WP_001295493.1.39780 WP_001295493.1.39796 WP_001295493.1.3980 WP_001295493.1.39809 WP_001295493.1.39818 WP_001295493.1.39820 WP_001295493.1.39822 WP_001295493.1.39829 WP_001295493.1.39867 WP_001295493.1.39870 WP_001295493.1.39892 WP_001295493.1.39938 WP_001295493.1.39961 WP_001295493.1.39966 WP_001295493.1.39970 WP_001295493.1.39973 WP_001295493.1.39992 WP_001295493.1.39998 WP_001295493.1.40 WP_001295493.1.40013 WP_001295493.1.40016 WP_001295493.1.40019 WP_001295493.1.4005 WP_001295493.1.40083 WP_001295493.1.40088 WP_001295493.1.40107 WP_001295493.1.40113 WP_001295493.1.40121 WP_001295493.1.40147 WP_001295493.1.40153 WP_001295493.1.40183 WP_001295493.1.40190 WP_001295493.1.40192 WP_001295493.1.4020 WP_001295493.1.40206 WP_001295493.1.40212 WP_001295493.1.40218 WP_001295493.1.40234 WP_001295493.1.40238 WP_001295493.1.40249 WP_001295493.1.40298 WP_001295493.1.4030 WP_001295493.1.40300 WP_001295493.1.40315 WP_001295493.1.40317 WP_001295493.1.40319 WP_001295493.1.40335 WP_001295493.1.40345 WP_001295493.1.40349 WP_001295493.1.40360 WP_001295493.1.40382 WP_001295493.1.40389 WP_001295493.1.40391 WP_001295493.1.40403 WP_001295493.1.40445 WP_001295493.1.40486 WP_001295493.1.4049 WP_001295493.1.40499 WP_001295493.1.40502 WP_001295493.1.40509 WP_001295493.1.40524 WP_001295493.1.40539 WP_001295493.1.40548 WP_001295493.1.40549 WP_001295493.1.40560 WP_001295493.1.40563 WP_001295493.1.40596 WP_001295493.1.40599 WP_001295493.1.406 WP_001295493.1.40607 WP_001295493.1.40617 WP_001295493.1.40623 WP_001295493.1.40629 WP_001295493.1.40636 WP_001295493.1.40657 WP_001295493.1.40660 WP_001295493.1.40666 WP_001295493.1.40668 WP_001295493.1.40686 WP_001295493.1.40712 WP_001295493.1.40715 WP_001295493.1.40742 WP_001295493.1.40758 WP_001295493.1.40781 WP_001295493.1.40793 WP_001295493.1.4081 WP_001295493.1.40813 WP_001295493.1.40815 WP_001295493.1.4082 WP_001295493.1.40833 WP_001295493.1.40842 WP_001295493.1.40843 WP_001295493.1.40865 WP_001295493.1.40882 WP_001295493.1.40893 WP_001295493.1.40900 WP_001295493.1.40912 WP_001295493.1.40937 WP_001295493.1.40952 WP_001295493.1.40965 WP_001295493.1.4103 WP_001295493.1.41037 WP_001295493.1.41041 WP_001295493.1.41045 WP_001295493.1.41060 WP_001295493.1.41063 WP_001295493.1.41078 WP_001295493.1.41125 WP_001295493.1.41147 WP_001295493.1.41206 WP_001295493.1.4122 WP_001295493.1.41230 WP_001295493.1.41239 WP_001295493.1.41244 WP_001295493.1.41259 WP_001295493.1.4126 WP_001295493.1.41263 WP_001295493.1.41271 WP_001295493.1.41287 WP_001295493.1.41294 WP_001295493.1.41315 WP_001295493.1.41330 WP_001295493.1.41332 WP_001295493.1.41339 WP_001295493.1.41346 WP_001295493.1.41363 WP_001295493.1.41368 WP_001295493.1.41371 WP_001295493.1.41372 WP_001295493.1.41391 WP_001295493.1.41392 WP_001295493.1.41394 WP_001295493.1.41401 WP_001295493.1.41402 WP_001295493.1.41407 WP_001295493.1.41417 WP_001295493.1.4142 WP_001295493.1.41436 WP_001295493.1.41449 WP_001295493.1.41453 WP_001295493.1.41455 WP_001295493.1.41457 WP_001295493.1.41466 WP_001295493.1.41478 WP_001295493.1.41479 WP_001295493.1.41482 WP_001295493.1.41483 WP_001295493.1.41484 WP_001295493.1.41488 WP_001295493.1.41513 WP_001295493.1.41530 WP_001295493.1.41536 WP_001295493.1.41539 WP_001295493.1.41545 WP_001295493.1.41556 WP_001295493.1.41566 WP_001295493.1.4158 WP_001295493.1.41606 WP_001295493.1.41613 WP_001295493.1.41621 WP_001295493.1.41651 WP_001295493.1.41654 WP_001295493.1.41712 WP_001295493.1.41718 WP_001295493.1.4172 WP_001295493.1.41734 WP_001295493.1.41740 WP_001295493.1.41752 WP_001295493.1.41778 WP_001295493.1.41780 WP_001295493.1.41783 WP_001295493.1.41784 WP_001295493.1.41809 WP_001295493.1.41812 WP_001295493.1.41813 WP_001295493.1.41822 WP_001295493.1.41826 WP_001295493.1.41837 WP_001295493.1.41849 WP_001295493.1.41900 WP_001295493.1.4193 WP_001295493.1.41956 WP_001295493.1.41960 WP_001295493.1.41964 WP_001295493.1.41988 WP_001295493.1.41990 WP_001295493.1.41991 WP_001295493.1.42022 WP_001295493.1.42033 WP_001295493.1.42036 WP_001295493.1.42038 WP_001295493.1.42044 WP_001295493.1.42060 WP_001295493.1.42073 WP_001295493.1.42095 WP_001295493.1.42096 WP_001295493.1.42113 WP_001295493.1.4213 WP_001295493.1.42138 WP_001295493.1.4214 WP_001295493.1.42159 WP_001295493.1.42179 WP_001295493.1.42191 WP_001295493.1.42203 WP_001295493.1.42209 WP_001295493.1.42214 WP_001295493.1.42221 WP_001295493.1.42226 WP_001295493.1.42233 WP_001295493.1.4224 WP_001295493.1.42252 WP_001295493.1.42258 WP_001295493.1.42277 WP_001295493.1.42284 WP_001295493.1.42300 WP_001295493.1.42318 WP_001295493.1.42359 WP_001295493.1.42367 WP_001295493.1.42369 WP_001295493.1.42376 WP_001295493.1.42387 WP_001295493.1.42415 WP_001295493.1.4242 WP_001295493.1.42432 WP_001295493.1.42442 WP_001295493.1.42443 WP_001295493.1.42447 WP_001295493.1.42448 WP_001295493.1.42456 WP_001295493.1.42480 WP_001295493.1.4250 WP_001295493.1.42513 WP_001295493.1.42522 WP_001295493.1.42547 WP_001295493.1.42594 WP_001295493.1.42597 WP_001295493.1.42600 WP_001295493.1.42601 WP_001295493.1.4261 WP_001295493.1.42632 WP_001295493.1.42638 WP_001295493.1.42661 WP_001295493.1.42669 WP_001295493.1.42677 WP_001295493.1.42709 WP_001295493.1.42728 WP_001295493.1.42748 WP_001295493.1.42749 WP_001295493.1.42750 WP_001295493.1.42756 WP_001295493.1.42761 WP_001295493.1.42770 WP_001295493.1.42771 WP_001295493.1.42791 WP_001295493.1.42813 WP_001295493.1.4282 WP_001295493.1.42828 WP_001295493.1.42830 WP_001295493.1.42832 WP_001295493.1.42863 WP_001295493.1.42879 WP_001295493.1.42891 WP_001295493.1.4290 WP_001295493.1.42903 WP_001295493.1.42918 WP_001295493.1.42936 WP_001295493.1.42937 WP_001295493.1.42962 WP_001295493.1.42966 WP_001295493.1.42970 WP_001295493.1.42975 WP_001295493.1.42987 WP_001295493.1.42989 WP_001295493.1.42991 WP_001295493.1.43013 WP_001295493.1.43027 WP_001295493.1.43035 WP_001295493.1.4306 WP_001295493.1.43079 WP_001295493.1.43121 WP_001295493.1.43123 WP_001295493.1.4313 WP_001295493.1.43132 WP_001295493.1.43133 WP_001295493.1.43137 WP_001295493.1.43140 WP_001295493.1.43166 WP_001295493.1.43170 WP_001295493.1.43174 WP_001295493.1.43177 WP_001295493.1.43196 WP_001295493.1.43213 WP_001295493.1.43216 WP_001295493.1.43239 WP_001295493.1.43270 WP_001295493.1.43278 WP_001295493.1.43316 WP_001295493.1.43324 WP_001295493.1.4334 WP_001295493.1.43363 WP_001295493.1.43374 WP_001295493.1.43384 WP_001295493.1.43389 WP_001295493.1.4342 WP_001295493.1.43427 WP_001295493.1.4343 WP_001295493.1.43444 WP_001295493.1.43448 WP_001295493.1.43455 WP_001295493.1.43469 WP_001295493.1.43473 WP_001295493.1.43474 WP_001295493.1.43489 WP_001295493.1.43501 WP_001295493.1.43536 WP_001295493.1.43561 WP_001295493.1.43566 WP_001295493.1.43598 WP_001295493.1.436 WP_001295493.1.43604 WP_001295493.1.43622 WP_001295493.1.43642 WP_001295493.1.43720 WP_001295493.1.43738 WP_001295493.1.43750 WP_001295493.1.43754 WP_001295493.1.43769 WP_001295493.1.43798 WP_001295493.1.43804 WP_001295493.1.43816 WP_001295493.1.43837 WP_001295493.1.43868 WP_001295493.1.43898 WP_001295493.1.43911 WP_001295493.1.43925 WP_001295493.1.43939 WP_001295493.1.43942 WP_001295493.1.43966 WP_001295493.1.43989 WP_001295493.1.4400 WP_001295493.1.44018 WP_001295493.1.44020 WP_001295493.1.44029 WP_001295493.1.44040 WP_001295493.1.44051 WP_001295493.1.44075 WP_001295493.1.44077 WP_001295493.1.44088 WP_001295493.1.44096 WP_001295493.1.44100 WP_001295493.1.4411 WP_001295493.1.44115 WP_001295493.1.44125 WP_001295493.1.44130 WP_001295493.1.4415 WP_001295493.1.44162 WP_001295493.1.44165 WP_001295493.1.44166 WP_001295493.1.44201 WP_001295493.1.44203 WP_001295493.1.44211 WP_001295493.1.44222 WP_001295493.1.44238 WP_001295493.1.44263 WP_001295493.1.44264 WP_001295493.1.44273 WP_001295493.1.44285 WP_001295493.1.44287 WP_001295493.1.44292 WP_001295493.1.44314 WP_001295493.1.44327 WP_001295493.1.44365 WP_001295493.1.44389 WP_001295493.1.44422 WP_001295493.1.44424 WP_001295493.1.44426 WP_001295493.1.44445 WP_001295493.1.44447 WP_001295493.1.4445 WP_001295493.1.44452 WP_001295493.1.44458 WP_001295493.1.44461 WP_001295493.1.44488 WP_001295493.1.4449 WP_001295493.1.44524 WP_001295493.1.44539 WP_001295493.1.4454 WP_001295493.1.44558 WP_001295493.1.44561 WP_001295493.1.44570 WP_001295493.1.44587 WP_001295493.1.4459 WP_001295493.1.44608 WP_001295493.1.44610 WP_001295493.1.44627 WP_001295493.1.44649 WP_001295493.1.44661 WP_001295493.1.44668 WP_001295493.1.44671 WP_001295493.1.44686 WP_001295493.1.4471 WP_001295493.1.44717 WP_001295493.1.44724 WP_001295493.1.4473 WP_001295493.1.44733 WP_001295493.1.44756 WP_001295493.1.44784 WP_001295493.1.448 WP_001295493.1.44814 WP_001295493.1.44818 WP_001295493.1.44821 WP_001295493.1.44836 WP_001295493.1.44840 WP_001295493.1.44841 WP_001295493.1.44848 WP_001295493.1.44849 WP_001295493.1.44854 WP_001295493.1.44855 WP_001295493.1.44857 WP_001295493.1.44906 WP_001295493.1.44923 WP_001295493.1.44954 WP_001295493.1.44960 WP_001295493.1.44961 WP_001295493.1.44970 WP_001295493.1.44975 WP_001295493.1.44977 WP_001295493.1.44980 WP_001295493.1.45020 WP_001295493.1.45025 WP_001295493.1.45028 WP_001295493.1.45043 WP_001295493.1.45053 WP_001295493.1.45068 WP_001295493.1.45076 WP_001295493.1.45104 WP_001295493.1.45116 WP_001295493.1.45153 WP_001295493.1.45156 WP_001295493.1.4516 WP_001295493.1.45190 WP_001295493.1.45195 WP_001295493.1.45208 WP_001295493.1.4524 WP_001295493.1.45246 WP_001295493.1.45293 WP_001295493.1.4530 WP_001295493.1.45301 WP_001295493.1.45313 WP_001295493.1.45329 WP_001295493.1.4535 WP_001295493.1.45359 WP_001295493.1.4538 WP_001295493.1.45392 WP_001295493.1.45404 WP_001295493.1.45405 WP_001295493.1.45444 WP_001295493.1.45486 WP_001295493.1.4549 WP_001295493.1.45494 WP_001295493.1.45500 WP_001295493.1.45525 WP_001295493.1.45536 WP_001295493.1.45538 WP_001295493.1.45565 WP_001295493.1.45575 WP_001295493.1.45581 WP_001295493.1.45595 WP_001295493.1.45600 WP_001295493.1.45627 WP_001295493.1.4563 WP_001295493.1.45664 WP_001295493.1.45674 WP_001295493.1.45676 WP_001295493.1.4570 WP_001295493.1.45707 WP_001295493.1.45718 WP_001295493.1.4574 WP_001295493.1.45740 WP_001295493.1.45741 WP_001295493.1.45752 WP_001295493.1.45789 WP_001295493.1.45793 WP_001295493.1.45799 WP_001295493.1.45801 WP_001295493.1.45806 WP_001295493.1.4583 WP_001295493.1.45840 WP_001295493.1.45841 WP_001295493.1.45846 WP_001295493.1.45865 WP_001295493.1.45868 WP_001295493.1.45891 WP_001295493.1.45901 WP_001295493.1.4593 WP_001295493.1.45930 WP_001295493.1.45931 WP_001295493.1.45933 WP_001295493.1.45941 WP_001295493.1.45945 WP_001295493.1.45949 WP_001295493.1.45960 WP_001295493.1.45962 WP_001295493.1.45968 WP_001295493.1.45991 WP_001295493.1.46016 WP_001295493.1.46026 WP_001295493.1.46027 WP_001295493.1.46039 WP_001295493.1.46048 WP_001295493.1.46049 WP_001295493.1.46070 WP_001295493.1.46081 WP_001295493.1.46097 WP_001295493.1.4610 WP_001295493.1.46105 WP_001295493.1.46115 WP_001295493.1.46122 WP_001295493.1.4613 WP_001295493.1.46164 WP_001295493.1.4617 WP_001295493.1.46186 WP_001295493.1.4619 WP_001295493.1.46197 WP_001295493.1.46213 WP_001295493.1.46217 WP_001295493.1.46239 WP_001295493.1.46245 WP_001295493.1.46257 WP_001295493.1.46282 WP_001295493.1.46283 WP_001295493.1.46291 WP_001295493.1.46301 WP_001295493.1.46325 WP_001295493.1.46329 WP_001295493.1.46369 WP_001295493.1.46378 WP_001295493.1.46379 WP_001295493.1.46414 WP_001295493.1.46429 WP_001295493.1.4643 WP_001295493.1.46433 WP_001295493.1.46438 WP_001295493.1.46441 WP_001295493.1.46451 WP_001295493.1.4646 WP_001295493.1.46468 WP_001295493.1.4647 WP_001295493.1.46477 WP_001295493.1.46487 WP_001295493.1.46526 WP_001295493.1.46531 WP_001295493.1.46541 WP_001295493.1.46552 WP_001295493.1.46555 WP_001295493.1.4657 WP_001295493.1.46573 WP_001295493.1.46582 WP_001295493.1.46589 WP_001295493.1.46594 WP_001295493.1.46597 WP_001295493.1.46602 WP_001295493.1.46611 WP_001295493.1.46614 WP_001295493.1.46616 WP_001295493.1.46626 WP_001295493.1.46643 WP_001295493.1.46655 WP_001295493.1.46668 WP_001295493.1.4670 WP_001295493.1.46734 WP_001295493.1.46743 WP_001295493.1.46795 WP_001295493.1.46802 WP_001295493.1.46806 WP_001295493.1.46810 WP_001295493.1.46820 WP_001295493.1.46821 WP_001295493.1.46832 WP_001295493.1.46841 WP_001295493.1.46857 WP_001295493.1.46860 WP_001295493.1.46876 WP_001295493.1.46882 WP_001295493.1.46898 WP_001295493.1.46909 WP_001295493.1.4691 WP_001295493.1.46912 WP_001295493.1.46913 WP_001295493.1.46932 WP_001295493.1.46990 WP_001295493.1.46994 WP_001295493.1.46999 WP_001295493.1.47028 WP_001295493.1.47029 WP_001295493.1.47030 WP_001295493.1.47034 WP_001295493.1.47038 WP_001295493.1.47047 WP_001295493.1.47048 WP_001295493.1.47050 WP_001295493.1.47054 WP_001295493.1.47063 WP_001295493.1.47069 WP_001295493.1.47073 WP_001295493.1.4708 WP_001295493.1.47124 WP_001295493.1.47140 WP_001295493.1.47156 WP_001295493.1.47167 WP_001295493.1.47186 WP_001295493.1.47189 WP_001295493.1.47197 WP_001295493.1.4722 WP_001295493.1.47224 WP_001295493.1.4723 WP_001295493.1.47235 WP_001295493.1.47246 WP_001295493.1.47247 WP_001295493.1.4725 WP_001295493.1.47280 WP_001295493.1.47307 WP_001295493.1.47316 WP_001295493.1.47319 WP_001295493.1.47322 WP_001295493.1.47332 WP_001295493.1.47344 WP_001295493.1.47349 WP_001295493.1.47350 WP_001295493.1.47356 WP_001295493.1.47363 WP_001295493.1.47366 WP_001295493.1.47370 WP_001295493.1.47386 WP_001295493.1.47398 WP_001295493.1.4740 WP_001295493.1.47401 WP_001295493.1.47411 WP_001295493.1.47414 WP_001295493.1.47416 WP_001295493.1.47425 WP_001295493.1.47451 WP_001295493.1.47454 WP_001295493.1.47473 WP_001295493.1.47477 WP_001295493.1.47496 WP_001295493.1.47498 WP_001295493.1.47500 WP_001295493.1.47529 WP_001295493.1.47546 WP_001295493.1.47555 WP_001295493.1.47582 WP_001295493.1.47599 WP_001295493.1.47634 WP_001295493.1.47646 WP_001295493.1.47654 WP_001295493.1.47662 WP_001295493.1.47673 WP_001295493.1.47709 WP_001295493.1.4772 WP_001295493.1.47722 WP_001295493.1.4773 WP_001295493.1.47734 WP_001295493.1.47744 WP_001295493.1.47761 WP_001295493.1.47764 WP_001295493.1.47765 WP_001295493.1.47770 WP_001295493.1.47775 WP_001295493.1.47784 WP_001295493.1.47790 WP_001295493.1.47791 WP_001295493.1.47820 WP_001295493.1.47827 WP_001295493.1.4783 WP_001295493.1.47848 WP_001295493.1.4785 WP_001295493.1.47884 WP_001295493.1.47914 WP_001295493.1.47935 WP_001295493.1.47954 WP_001295493.1.4796 WP_001295493.1.47962 WP_001295493.1.47976 WP_001295493.1.47981 WP_001295493.1.47983 WP_001295493.1.47994 WP_001295493.1.48000 WP_001295493.1.48018 WP_001295493.1.48029 WP_001295493.1.48040 WP_001295493.1.48048 WP_001295493.1.48051 WP_001295493.1.48065 WP_001295493.1.48073 WP_001295493.1.48077 WP_001295493.1.48080 WP_001295493.1.48087 WP_001295493.1.48090 WP_001295493.1.48096 WP_001295493.1.48111 WP_001295493.1.4812 WP_001295493.1.48144 WP_001295493.1.48168 WP_001295493.1.48176 WP_001295493.1.48188 WP_001295493.1.48194 WP_001295493.1.48203 WP_001295493.1.48216 WP_001295493.1.48222 WP_001295493.1.48226 WP_001295493.1.48229 WP_001295493.1.48258 WP_001295493.1.4826 WP_001295493.1.48265 WP_001295493.1.48285 WP_001295493.1.48290 WP_001295493.1.48291 WP_001295493.1.48317 WP_001295493.1.48353 WP_001295493.1.48355 WP_001295493.1.48371 WP_001295493.1.48385 WP_001295493.1.48404 WP_001295493.1.48417 WP_001295493.1.48421 WP_001295493.1.48431 WP_001295493.1.48433 WP_001295493.1.48469 WP_001295493.1.48477 WP_001295493.1.48480 WP_001295493.1.48483 WP_001295493.1.48505 WP_001295493.1.4857 WP_001295493.1.48571 WP_001295493.1.48590 WP_001295493.1.486 WP_001295493.1.48602 WP_001295493.1.48615 WP_001295493.1.48626 WP_001295493.1.48678 WP_001295493.1.48689 WP_001295493.1.48697 WP_001295493.1.4871 WP_001295493.1.48712 WP_001295493.1.4876 WP_001295493.1.48771 WP_001295493.1.48792 WP_001295493.1.48801 WP_001295493.1.48806 WP_001295493.1.48825 WP_001295493.1.48827 WP_001295493.1.48847 WP_001295493.1.48860 WP_001295493.1.48901 WP_001295493.1.48907 WP_001295493.1.48910 WP_001295493.1.48921 WP_001295493.1.48926 WP_001295493.1.48928 WP_001295493.1.48953 WP_001295493.1.48954 WP_001295493.1.48970 WP_001295493.1.48974 WP_001295493.1.49001 WP_001295493.1.49009 WP_001295493.1.49104 WP_001295493.1.49107 WP_001295493.1.49124 WP_001295493.1.49136 WP_001295493.1.49147 WP_001295493.1.49170 WP_001295493.1.49179 WP_001295493.1.49190 WP_001295493.1.49229 WP_001295493.1.49236 WP_001295493.1.49243 WP_001295493.1.49258 WP_001295493.1.49259 WP_001295493.1.49275 WP_001295493.1.4931 WP_001295493.1.49312 WP_001295493.1.49321 WP_001295493.1.49332 WP_001295493.1.49336 WP_001295493.1.49338 WP_001295493.1.49347 WP_001295493.1.49401 WP_001295493.1.49431 WP_001295493.1.49459 WP_001295493.1.49464 WP_001295493.1.49481 WP_001295493.1.49482 WP_001295493.1.49483 WP_001295493.1.4949 WP_001295493.1.49496 WP_001295493.1.49521 WP_001295493.1.49528 WP_001295493.1.4953 WP_001295493.1.49531 WP_001295493.1.49537 WP_001295493.1.49546 WP_001295493.1.49558 WP_001295493.1.49567 WP_001295493.1.49594 WP_001295493.1.49599 WP_001295493.1.49615 WP_001295493.1.49621 WP_001295493.1.49625 WP_001295493.1.49645 WP_001295493.1.49655 WP_001295493.1.49661 WP_001295493.1.49684 WP_001295493.1.49712 WP_001295493.1.49722 WP_001295493.1.49733 WP_001295493.1.49740 WP_001295493.1.49747 WP_001295493.1.49768 WP_001295493.1.49771 WP_001295493.1.49774 WP_001295493.1.49777 WP_001295493.1.49783 WP_001295493.1.49788 WP_001295493.1.49823 WP_001295493.1.49856 WP_001295493.1.49861 WP_001295493.1.49879 WP_001295493.1.49883 WP_001295493.1.49884 WP_001295493.1.49900 WP_001295493.1.49902 WP_001295493.1.49941 WP_001295493.1.49950 WP_001295493.1.49954 WP_001295493.1.49972 WP_001295493.1.49987 WP_001295493.1.50006 WP_001295493.1.50008 WP_001295493.1.5003 WP_001295493.1.50036 WP_001295493.1.50056 WP_001295493.1.50058 WP_001295493.1.50078 WP_001295493.1.50098 WP_001295493.1.50110 WP_001295493.1.50113 WP_001295493.1.50119 WP_001295493.1.50136 WP_001295493.1.50146 WP_001295493.1.5017 WP_001295493.1.50182 WP_001295493.1.50187 WP_001295493.1.50191 WP_001295493.1.50196 WP_001295493.1.50207 WP_001295493.1.50214 WP_001295493.1.50228 WP_001295493.1.50230 WP_001295493.1.50258 WP_001295493.1.50262 WP_001295493.1.50266 WP_001295493.1.50269 WP_001295493.1.50270 WP_001295493.1.50273 WP_001295493.1.50278 WP_001295493.1.50304 WP_001295493.1.50329 WP_001295493.1.50345 WP_001295493.1.50353 WP_001295493.1.50358 WP_001295493.1.50361 WP_001295493.1.50366 WP_001295493.1.5037 WP_001295493.1.50380 WP_001295493.1.50381 WP_001295493.1.5040 WP_001295493.1.5041 WP_001295493.1.50412 WP_001295493.1.50418 WP_001295493.1.50446 WP_001295493.1.50452 WP_001295493.1.5046 WP_001295493.1.50539 WP_001295493.1.50548 WP_001295493.1.50549 WP_001295493.1.5056 WP_001295493.1.50564 WP_001295493.1.50579 WP_001295493.1.50585 WP_001295493.1.50586 WP_001295493.1.506 WP_001295493.1.5061 WP_001295493.1.50616 WP_001295493.1.50627 WP_001295493.1.5064 WP_001295493.1.5067 WP_001295493.1.50690 WP_001295493.1.50715 WP_001295493.1.50717 WP_001295493.1.50725 WP_001295493.1.50728 WP_001295493.1.50762 WP_001295493.1.50925 WP_001295493.1.50936 WP_001295493.1.50939 WP_001295493.1.50947 WP_001295493.1.50969 WP_001295493.1.50986 WP_001295493.1.50988 WP_001295493.1.50990 WP_001295493.1.50993 WP_001295493.1.50996 WP_001295493.1.51013 WP_001295493.1.51027 WP_001295493.1.51042 WP_001295493.1.51058 WP_001295493.1.5106 WP_001295493.1.511 WP_001295493.1.51109 WP_001295493.1.51127 WP_001295493.1.51154 WP_001295493.1.51170 WP_001295493.1.51171 WP_001295493.1.51172 WP_001295493.1.51175 WP_001295493.1.51180 WP_001295493.1.51190 WP_001295493.1.51201 WP_001295493.1.51206 WP_001295493.1.51211 WP_001295493.1.5124 WP_001295493.1.51248 WP_001295493.1.51253 WP_001295493.1.51255 WP_001295493.1.51260 WP_001295493.1.51278 WP_001295493.1.5128 WP_001295493.1.51299 WP_001295493.1.51300 WP_001295493.1.51307 WP_001295493.1.51323 WP_001295493.1.51336 WP_001295493.1.51354 WP_001295493.1.51360 WP_001295493.1.51364 WP_001295493.1.51380 WP_001295493.1.51392 WP_001295493.1.51405 WP_001295493.1.51425 WP_001295493.1.51426 WP_001295493.1.51427 WP_001295493.1.51430 WP_001295493.1.51441 WP_001295493.1.5146 WP_001295493.1.51462 WP_001295493.1.51482 WP_001295493.1.51490 WP_001295493.1.51495 WP_001295493.1.51503 WP_001295493.1.51505 WP_001295493.1.51513 WP_001295493.1.51525 WP_001295493.1.5153 WP_001295493.1.51537 WP_001295493.1.51539 WP_001295493.1.51542 WP_001295493.1.51552 WP_001295493.1.5157 WP_001295493.1.5158 WP_001295493.1.51580 WP_001295493.1.51587 WP_001295493.1.51596 WP_001295493.1.51600 WP_001295493.1.51607 WP_001295493.1.51624 WP_001295493.1.51629 WP_001295493.1.51643 WP_001295493.1.51662 WP_001295493.1.51690 WP_001295493.1.51693 WP_001295493.1.51707 WP_001295493.1.51718 WP_001295493.1.51736 WP_001295493.1.51760 WP_001295493.1.51784 WP_001295493.1.51804 WP_001295493.1.51834 WP_001295493.1.51837 WP_001295493.1.51839 WP_001295493.1.51869 WP_001295493.1.51873 WP_001295493.1.51899 WP_001295493.1.51906 WP_001295493.1.51949 WP_001295493.1.51968 WP_001295493.1.51979 WP_001295493.1.51985 WP_001295493.1.51988 WP_001295493.1.52002 WP_001295493.1.52011 WP_001295493.1.52020 WP_001295493.1.52039 WP_001295493.1.52044 WP_001295493.1.52048 WP_001295493.1.52062 WP_001295493.1.52076 WP_001295493.1.52085 WP_001295493.1.52098 WP_001295493.1.52111 WP_001295493.1.52126 WP_001295493.1.52127 WP_001295493.1.52135 WP_001295493.1.52137 WP_001295493.1.5217 WP_001295493.1.52171 WP_001295493.1.52186 WP_001295493.1.52200 WP_001295493.1.52213 WP_001295493.1.52214 WP_001295493.1.52225 WP_001295493.1.52230 WP_001295493.1.52236 WP_001295493.1.52240 WP_001295493.1.52243 WP_001295493.1.52249 WP_001295493.1.52257 WP_001295493.1.52258 WP_001295493.1.5227 WP_001295493.1.52271 WP_001295493.1.52272 WP_001295493.1.52299 WP_001295493.1.52304 WP_001295493.1.52305 WP_001295493.1.52313 WP_001295493.1.52324 WP_001295493.1.52328 WP_001295493.1.52333 WP_001295493.1.52378 WP_001295493.1.5239 WP_001295493.1.52406 WP_001295493.1.52413 WP_001295493.1.52419 WP_001295493.1.52421 WP_001295493.1.52492 WP_001295493.1.52496 WP_001295493.1.52524 WP_001295493.1.52543 WP_001295493.1.52544 WP_001295493.1.52554 WP_001295493.1.52558 WP_001295493.1.52567 WP_001295493.1.52601 WP_001295493.1.52612 WP_001295493.1.5265 WP_001295493.1.52662 WP_001295493.1.52691 WP_001295493.1.52704 WP_001295493.1.52710 WP_001295493.1.5272 WP_001295493.1.52735 WP_001295493.1.52755 WP_001295493.1.52762 WP_001295493.1.52774 WP_001295493.1.52777 WP_001295493.1.52780 WP_001295493.1.52781 WP_001295493.1.52801 WP_001295493.1.52844 WP_001295493.1.52846 WP_001295493.1.52852 WP_001295493.1.52853 WP_001295493.1.52855 WP_001295493.1.52881 WP_001295493.1.52883 WP_001295493.1.52895 WP_001295493.1.52908 WP_001295493.1.5291 WP_001295493.1.52913 WP_001295493.1.52933 WP_001295493.1.52942 WP_001295493.1.52945 WP_001295493.1.52962 WP_001295493.1.52995 WP_001295493.1.52996 WP_001295493.1.53012 WP_001295493.1.53020 WP_001295493.1.53021 WP_001295493.1.53027 WP_001295493.1.53065 WP_001295493.1.53084 WP_001295493.1.53095 WP_001295493.1.53099 WP_001295493.1.5310 WP_001295493.1.53110 WP_001295493.1.53155 WP_001295493.1.53162 WP_001295493.1.53181 WP_001295493.1.53186 WP_001295493.1.532 WP_001295493.1.53211 WP_001295493.1.5322 WP_001295493.1.53223 WP_001295493.1.53228 WP_001295493.1.53238 WP_001295493.1.53242 WP_001295493.1.53251 WP_001295493.1.53252 WP_001295493.1.53262 WP_001295493.1.53270 WP_001295493.1.53277 WP_001295493.1.53308 WP_001295493.1.53327 WP_001295493.1.53356 WP_001295493.1.53360 WP_001295493.1.53364 WP_001295493.1.53377 WP_001295493.1.53401 WP_001295493.1.53415 WP_001295493.1.53419 WP_001295493.1.5342 WP_001295493.1.53428 WP_001295493.1.53431 WP_001295493.1.53482 WP_001295493.1.53505 WP_001295493.1.5351 WP_001295493.1.53535 WP_001295493.1.53537 WP_001295493.1.53545 WP_001295493.1.53556 WP_001295493.1.53574 WP_001295493.1.53582 WP_001295493.1.53589 WP_001295493.1.53590 WP_001295493.1.53592 WP_001295493.1.53594 WP_001295493.1.5362 WP_001295493.1.53642 WP_001295493.1.53645 WP_001295493.1.53687 WP_001295493.1.53706 WP_001295493.1.53769 WP_001295493.1.53809 WP_001295493.1.53810 WP_001295493.1.53811 WP_001295493.1.53841 WP_001295493.1.53863 WP_001295493.1.53866 WP_001295493.1.53878 WP_001295493.1.53884 WP_001295493.1.5391 WP_001295493.1.5393 WP_001295493.1.5395 WP_001295493.1.53966 WP_001295493.1.53968 WP_001295493.1.53972 WP_001295493.1.53978 WP_001295493.1.53991 WP_001295493.1.53994 WP_001295493.1.54002 WP_001295493.1.54013 WP_001295493.1.54023 WP_001295493.1.54024 WP_001295493.1.54028 WP_001295493.1.54032 WP_001295493.1.54051 WP_001295493.1.54072 WP_001295493.1.54091 WP_001295493.1.54095 WP_001295493.1.54104 WP_001295493.1.54144 WP_001295493.1.54169 WP_001295493.1.54185 WP_001295493.1.54188 WP_001295493.1.54202 WP_001295493.1.54208 WP_001295493.1.54213 WP_001295493.1.54263 WP_001295493.1.54307 WP_001295493.1.54313 WP_001295493.1.54317 WP_001295493.1.54328 WP_001295493.1.54329 WP_001295493.1.5433 WP_001295493.1.5434 WP_001295493.1.54344 WP_001295493.1.54359 WP_001295493.1.5440 WP_001295493.1.5441 WP_001295493.1.54411 WP_001295493.1.54418 WP_001295493.1.54439 WP_001295493.1.54454 WP_001295493.1.54463 WP_001295493.1.54476 WP_001295493.1.54507 WP_001295493.1.54524 WP_001295493.1.54534 WP_001295493.1.54546 WP_001295493.1.54585 WP_001295493.1.54590 WP_001295493.1.54591 WP_001295493.1.5460 WP_001295493.1.54601 WP_001295493.1.54602 WP_001295493.1.54605 WP_001295493.1.54614 WP_001295493.1.54617 WP_001295493.1.54620 WP_001295493.1.54625 WP_001295493.1.54638 WP_001295493.1.54641 WP_001295493.1.54643 WP_001295493.1.5467 WP_001295493.1.54688 WP_001295493.1.5470 WP_001295493.1.54708 WP_001295493.1.54725 WP_001295493.1.54754 WP_001295493.1.54755 WP_001295493.1.54760 WP_001295493.1.54769 WP_001295493.1.5478 WP_001295493.1.5479 WP_001295493.1.54798 WP_001295493.1.54817 WP_001295493.1.54829 WP_001295493.1.5486 WP_001295493.1.54883 WP_001295493.1.54918 WP_001295493.1.54921 WP_001295493.1.54941 WP_001295493.1.54946 WP_001295493.1.54972 WP_001295493.1.54981 WP_001295493.1.54989 WP_001295493.1.54991 WP_001295493.1.54993 WP_001295493.1.55003 WP_001295493.1.55005 WP_001295493.1.55009 WP_001295493.1.55041 WP_001295493.1.55070 WP_001295493.1.55112 WP_001295493.1.55115 WP_001295493.1.55123 WP_001295493.1.55134 WP_001295493.1.55144 WP_001295493.1.55149 WP_001295493.1.55151 WP_001295493.1.55177 WP_001295493.1.55185 WP_001295493.1.55197 WP_001295493.1.5520 WP_001295493.1.55203 WP_001295493.1.55218 WP_001295493.1.55222 WP_001295493.1.55226 WP_001295493.1.55275 WP_001295493.1.55286 WP_001295493.1.55291 WP_001295493.1.55338 WP_001295493.1.55342 WP_001295493.1.55357 WP_001295493.1.55359 WP_001295493.1.55374 WP_001295493.1.55381 WP_001295493.1.55417 WP_001295493.1.55420 WP_001295493.1.55424 WP_001295493.1.55425 WP_001295493.1.5546 WP_001295493.1.55466 WP_001295493.1.55482 WP_001295493.1.55483 WP_001295493.1.55489 WP_001295493.1.55492 WP_001295493.1.55507 WP_001295493.1.55529 WP_001295493.1.55551 WP_001295493.1.55552 WP_001295493.1.55556 WP_001295493.1.55560 WP_001295493.1.55563 WP_001295493.1.55571 WP_001295493.1.55574 WP_001295493.1.55581 WP_001295493.1.55597 WP_001295493.1.55608 WP_001295493.1.5561 WP_001295493.1.55629 WP_001295493.1.5566 WP_001295493.1.55676 WP_001295493.1.5570 WP_001295493.1.55709 WP_001295493.1.55720 WP_001295493.1.55727 WP_001295493.1.55730 WP_001295493.1.55731 WP_001295493.1.55757 WP_001295493.1.55787 WP_001295493.1.55790 WP_001295493.1.55791 WP_001295493.1.55808 WP_001295493.1.55820 WP_001295493.1.55825 WP_001295493.1.55838 WP_001295493.1.55844 WP_001295493.1.55868 WP_001295493.1.55870 WP_001295493.1.55888 WP_001295493.1.55892 WP_001295493.1.55897 WP_001295493.1.55979 WP_001295493.1.55981 WP_001295493.1.55988 WP_001295493.1.55990 WP_001295493.1.56033 WP_001295493.1.56040 WP_001295493.1.56047 WP_001295493.1.56072 WP_001295493.1.56101 WP_001295493.1.56122 WP_001295493.1.56139 WP_001295493.1.5614 WP_001295493.1.56142 WP_001295493.1.56149 WP_001295493.1.56151 WP_001295493.1.5616 WP_001295493.1.56164 WP_001295493.1.56169 WP_001295493.1.56177 WP_001295493.1.56193 WP_001295493.1.562 WP_001295493.1.56231 WP_001295493.1.56278 WP_001295493.1.56285 WP_001295493.1.56293 WP_001295493.1.56302 WP_001295493.1.5632 WP_001295493.1.56338 WP_001295493.1.56345 WP_001295493.1.56358 WP_001295493.1.56371 WP_001295493.1.56388 WP_001295493.1.5639 WP_001295493.1.56390 WP_001295493.1.56392 WP_001295493.1.56399 WP_001295493.1.56402 WP_001295493.1.56436 WP_001295493.1.56439 WP_001295493.1.56446 WP_001295493.1.56457 WP_001295493.1.5646 WP_001295493.1.56481 WP_001295493.1.56489 WP_001295493.1.5649 WP_001295493.1.56491 WP_001295493.1.56501 WP_001295493.1.56502 WP_001295493.1.56513 WP_001295493.1.56523 WP_001295493.1.56528 WP_001295493.1.56543 WP_001295493.1.56554 WP_001295493.1.56571 WP_001295493.1.56573 WP_001295493.1.56586 WP_001295493.1.56662 WP_001295493.1.56665 WP_001295493.1.56680 WP_001295493.1.56689 WP_001295493.1.5670 WP_001295493.1.56704 WP_001295493.1.56713 WP_001295493.1.56714 WP_001295493.1.56721 WP_001295493.1.56742 WP_001295493.1.56776 WP_001295493.1.56777 WP_001295493.1.56786 WP_001295493.1.56787 WP_001295493.1.56789 WP_001295493.1.56799 WP_001295493.1.56821 WP_001295493.1.56830 WP_001295493.1.56835 WP_001295493.1.56846 WP_001295493.1.5685 WP_001295493.1.56871 WP_001295493.1.56882 WP_001295493.1.56908 WP_001295493.1.56932 WP_001295493.1.56933 WP_001295493.1.56934 WP_001295493.1.56936 WP_001295493.1.56937 WP_001295493.1.56941 WP_001295493.1.56951 WP_001295493.1.56978 WP_001295493.1.56980 WP_001295493.1.56992 WP_001295493.1.57011 WP_001295493.1.57032 WP_001295493.1.57045 WP_001295493.1.57051 WP_001295493.1.57068 WP_001295493.1.57071 WP_001295493.1.57072 WP_001295493.1.57086 WP_001295493.1.57100 WP_001295493.1.57124 WP_001295493.1.57150 WP_001295493.1.57159 WP_001295493.1.57180 WP_001295493.1.57181 WP_001295493.1.57182 WP_001295493.1.57185 WP_001295493.1.57197 WP_001295493.1.57213 WP_001295493.1.57216 WP_001295493.1.57222 WP_001295493.1.57254 WP_001295493.1.57266 WP_001295493.1.57269 WP_001295493.1.57278 WP_001295493.1.57280 WP_001295493.1.57281 WP_001295493.1.57319 WP_001295493.1.57348 WP_001295493.1.57349 WP_001295493.1.57386 WP_001295493.1.57395 WP_001295493.1.57401 WP_001295493.1.57403 WP_001295493.1.57410 WP_001295493.1.57414 WP_001295493.1.5742 WP_001295493.1.57432 WP_001295493.1.57451 WP_001295493.1.57453 WP_001295493.1.57466 WP_001295493.1.57487 WP_001295493.1.57517 WP_001295493.1.57538 WP_001295493.1.5755 WP_001295493.1.57550 WP_001295493.1.57558 WP_001295493.1.57574 WP_001295493.1.57588 WP_001295493.1.57608 WP_001295493.1.57610 WP_001295493.1.57628 WP_001295493.1.57629 WP_001295493.1.57634 WP_001295493.1.57638 WP_001295493.1.5764 WP_001295493.1.57646 WP_001295493.1.57659 WP_001295493.1.57663 WP_001295493.1.57669 WP_001295493.1.57719 WP_001295493.1.57738 WP_001295493.1.57812 WP_001295493.1.57832 WP_001295493.1.57836 WP_001295493.1.57846 WP_001295493.1.57851 WP_001295493.1.5787 WP_001295493.1.57898 WP_001295493.1.57903 WP_001295493.1.57904 WP_001295493.1.57920 WP_001295493.1.57951 WP_001295493.1.57975 WP_001295493.1.57982 WP_001295493.1.57983 WP_001295493.1.57994 WP_001295493.1.58001 WP_001295493.1.58022 WP_001295493.1.58045 WP_001295493.1.58048 WP_001295493.1.58057 WP_001295493.1.58060 WP_001295493.1.58080 WP_001295493.1.58092 WP_001295493.1.58094 WP_001295493.1.58097 WP_001295493.1.58098 WP_001295493.1.5810 WP_001295493.1.5812 WP_001295493.1.58136 WP_001295493.1.58143 WP_001295493.1.58146 WP_001295493.1.58163 WP_001295493.1.58169 WP_001295493.1.58172 WP_001295493.1.58206 WP_001295493.1.58226 WP_001295493.1.58232 WP_001295493.1.58233 WP_001295493.1.58238 WP_001295493.1.58248 WP_001295493.1.58267 WP_001295493.1.58292 WP_001295493.1.58316 WP_001295493.1.58336 WP_001295493.1.58340 WP_001295493.1.58345 WP_001295493.1.58368 WP_001295493.1.58384 WP_001295493.1.58401 WP_001295493.1.58408 WP_001295493.1.58414 WP_001295493.1.5842 WP_001295493.1.58420 WP_001295493.1.58423 WP_001295493.1.58429 WP_001295493.1.58440 WP_001295493.1.58444 WP_001295493.1.58445 WP_001295493.1.58449 WP_001295493.1.58475 WP_001295493.1.58484 WP_001295493.1.58496 WP_001295493.1.58507 WP_001295493.1.58514 WP_001295493.1.5852 WP_001295493.1.58528 WP_001295493.1.58547 WP_001295493.1.58552 WP_001295493.1.58560 WP_001295493.1.58572 WP_001295493.1.58582 WP_001295493.1.58609 WP_001295493.1.58617 WP_001295493.1.58622 WP_001295493.1.58680 WP_001295493.1.58705 WP_001295493.1.58707 WP_001295493.1.58723 WP_001295493.1.58799 WP_001295493.1.58837 WP_001295493.1.58867 WP_001295493.1.58870 WP_001295493.1.58901 WP_001295493.1.58940 WP_001295493.1.58942 WP_001295493.1.58951 WP_001295493.1.58958 WP_001295493.1.58976 WP_001295493.1.58977 WP_001295493.1.58983 WP_001295493.1.58999 WP_001295493.1.59024 WP_001295493.1.59026 WP_001295493.1.59038 WP_001295493.1.59047 WP_001295493.1.59055 WP_001295493.1.5906 WP_001295493.1.59060 WP_001295493.1.59073 WP_001295493.1.59083 WP_001295493.1.59119 WP_001295493.1.59165 WP_001295493.1.59174 WP_001295493.1.59190 WP_001295493.1.59199 WP_001295493.1.59218 WP_001295493.1.59226 WP_001295493.1.59263 WP_001295493.1.59280 WP_001295493.1.59292 WP_001295493.1.59293 WP_001295493.1.59302 WP_001295493.1.59306 WP_001295493.1.59359 WP_001295493.1.59374 WP_001295493.1.59395 WP_001295493.1.59396 WP_001295493.1.59407 WP_001295493.1.59409 WP_001295493.1.59413 WP_001295493.1.5942 WP_001295493.1.59423 WP_001295493.1.59426 WP_001295493.1.59434 WP_001295493.1.59470 WP_001295493.1.59483 WP_001295493.1.59491 WP_001295493.1.59513 WP_001295493.1.59533 WP_001295493.1.59553 WP_001295493.1.59572 WP_001295493.1.59577 WP_001295493.1.59579 WP_001295493.1.59590 WP_001295493.1.59615 WP_001295493.1.59621 WP_001295493.1.5963 WP_001295493.1.59638 WP_001295493.1.5965 WP_001295493.1.59660 WP_001295493.1.59679 WP_001295493.1.59689 WP_001295493.1.59699 WP_001295493.1.597 WP_001295493.1.59717 WP_001295493.1.59730 WP_001295493.1.59733 WP_001295493.1.59737 WP_001295493.1.59745 WP_001295493.1.59748 WP_001295493.1.59756 WP_001295493.1.59781 WP_001295493.1.59782 WP_001295493.1.59788 WP_001295493.1.59791 WP_001295493.1.59793 WP_001295493.1.59815 WP_001295493.1.59823 WP_001295493.1.59836 WP_001295493.1.59838 WP_001295493.1.59853 WP_001295493.1.59855 WP_001295493.1.59858 WP_001295493.1.59877 WP_001295493.1.5990 WP_001295493.1.59900 WP_001295493.1.59905 WP_001295493.1.59912 WP_001295493.1.59914 WP_001295493.1.59931 WP_001295493.1.59932 WP_001295493.1.59959 WP_001295493.1.59970 WP_001295493.1.59989 WP_001295493.1.59998 WP_001295493.1.60005 WP_001295493.1.6002 WP_001295493.1.60023 WP_001295493.1.60031 WP_001295493.1.60042 WP_001295493.1.60043 WP_001295493.1.60048 WP_001295493.1.60067 WP_001295493.1.60070 WP_001295493.1.60095 WP_001295493.1.60110 WP_001295493.1.60117 WP_001295493.1.6013 WP_001295493.1.60133 WP_001295493.1.60151 WP_001295493.1.60186 WP_001295493.1.6022 WP_001295493.1.60225 WP_001295493.1.60228 WP_001295493.1.60235 WP_001295493.1.60246 WP_001295493.1.60304 WP_001295493.1.60325 WP_001295493.1.60337 WP_001295493.1.60342 WP_001295493.1.60343 WP_001295493.1.60350 WP_001295493.1.60373 WP_001295493.1.60374 WP_001295493.1.60387 WP_001295493.1.60411 WP_001295493.1.60436 WP_001295493.1.60443 WP_001295493.1.60453 WP_001295493.1.60457 WP_001295493.1.60461 WP_001295493.1.60477 WP_001295493.1.60491 WP_001295493.1.60498 WP_001295493.1.60505 WP_001295493.1.60544 WP_001295493.1.60550 WP_001295493.1.60555 WP_001295493.1.60559 WP_001295493.1.60567 WP_001295493.1.60570 WP_001295493.1.60576 WP_001295493.1.6059 WP_001295493.1.60599 WP_001295493.1.60606 WP_001295493.1.6061 WP_001295493.1.60613 WP_001295493.1.60614 WP_001295493.1.6064 WP_001295493.1.60644 WP_001295493.1.60647 WP_001295493.1.6066 WP_001295493.1.60671 WP_001295493.1.6068 WP_001295493.1.60684 WP_001295493.1.60698 WP_001295493.1.60717 WP_001295493.1.60732 WP_001295493.1.60744 WP_001295493.1.60761 WP_001295493.1.60764 WP_001295493.1.60771 WP_001295493.1.60805 WP_001295493.1.60816 WP_001295493.1.60826 WP_001295493.1.60832 WP_001295493.1.60835 WP_001295493.1.60847 WP_001295493.1.60872 WP_001295493.1.60895 WP_001295493.1.60901 WP_001295493.1.60921 WP_001295493.1.60925 WP_001295493.1.60927 WP_001295493.1.60935 WP_001295493.1.6094 WP_001295493.1.60974 WP_001295493.1.61006 WP_001295493.1.61008 WP_001295493.1.61039 WP_001295493.1.61058 WP_001295493.1.61096 WP_001295493.1.61097 WP_001295493.1.61099 WP_001295493.1.6110 WP_001295493.1.61102 WP_001295493.1.61108 WP_001295493.1.61112 WP_001295493.1.61121 WP_001295493.1.61132 WP_001295493.1.61148 WP_001295493.1.61170 WP_001295493.1.61174 WP_001295493.1.61175 WP_001295493.1.61181 WP_001295493.1.61183 WP_001295493.1.61186 WP_001295493.1.61223 WP_001295493.1.61225 WP_001295493.1.61241 WP_001295493.1.61245 WP_001295493.1.61253 WP_001295493.1.61268 WP_001295493.1.61284 WP_001295493.1.61292 WP_001295493.1.61360 WP_001295493.1.61362 WP_001295493.1.61364 WP_001295493.1.61373 WP_001295493.1.6138 WP_001295493.1.61398 WP_001295493.1.61445 WP_001295493.1.61480 WP_001295493.1.61496 WP_001295493.1.615 WP_001295493.1.61505 WP_001295493.1.61512 WP_001295493.1.61517 WP_001295493.1.61524 WP_001295493.1.61551 WP_001295493.1.61608 WP_001295493.1.61612 WP_001295493.1.61617 WP_001295493.1.61623 WP_001295493.1.61636 WP_001295493.1.61643 WP_001295493.1.61663 WP_001295493.1.61703 WP_001295493.1.61718 WP_001295493.1.61739 WP_001295493.1.61758 WP_001295493.1.61770 WP_001295493.1.61772 WP_001295493.1.61779 WP_001295493.1.61789 WP_001295493.1.618 WP_001295493.1.61806 WP_001295493.1.61822 WP_001295493.1.61835 WP_001295493.1.61853 WP_001295493.1.61858 WP_001295493.1.61874 WP_001295493.1.61893 WP_001295493.1.61926 WP_001295493.1.61939 WP_001295493.1.61948 WP_001295493.1.61949 WP_001295493.1.61955 WP_001295493.1.61957 WP_001295493.1.61966 WP_001295493.1.61985 WP_001295493.1.62041 WP_001295493.1.62043 WP_001295493.1.62091 WP_001295493.1.62099 WP_001295493.1.62102 WP_001295493.1.6212 WP_001295493.1.62135 WP_001295493.1.62157 WP_001295493.1.62182 WP_001295493.1.62207 WP_001295493.1.62262 WP_001295493.1.62264 WP_001295493.1.62266 WP_001295493.1.62273 WP_001295493.1.62290 WP_001295493.1.62296 WP_001295493.1.62303 WP_001295493.1.62322 WP_001295493.1.62337 WP_001295493.1.62348 WP_001295493.1.62358 WP_001295493.1.62424 WP_001295493.1.62447 WP_001295493.1.6245 WP_001295493.1.62454 WP_001295493.1.62460 WP_001295493.1.62480 WP_001295493.1.62487 WP_001295493.1.62503 WP_001295493.1.62507 WP_001295493.1.62513 WP_001295493.1.62514 WP_001295493.1.62529 WP_001295493.1.62555 WP_001295493.1.62586 WP_001295493.1.6261 WP_001295493.1.62612 WP_001295493.1.62631 WP_001295493.1.62642 WP_001295493.1.62668 WP_001295493.1.62675 WP_001295493.1.62681 WP_001295493.1.62714 WP_001295493.1.62735 WP_001295493.1.62750 WP_001295493.1.62762 WP_001295493.1.62769 WP_001295493.1.62780 WP_001295493.1.62784 WP_001295493.1.62787 WP_001295493.1.62788 WP_001295493.1.62802 WP_001295493.1.62812 WP_001295493.1.62818 WP_001295493.1.62840 WP_001295493.1.62843 WP_001295493.1.62850 WP_001295493.1.62851 WP_001295493.1.62885 WP_001295493.1.62888 WP_001295493.1.62914 WP_001295493.1.6293 WP_001295493.1.62931 WP_001295493.1.62959 WP_001295493.1.62973 WP_001295493.1.62989 WP_001295493.1.6299 WP_001295493.1.62992 WP_001295493.1.63023 WP_001295493.1.63078 WP_001295493.1.63167 WP_001295493.1.63177 WP_001295493.1.63189 WP_001295493.1.6323 WP_001295493.1.63246 WP_001295493.1.63285 WP_001295493.1.63287 WP_001295493.1.6331 WP_001295493.1.63310 WP_001295493.1.6334 WP_001295493.1.63350 WP_001295493.1.6337 WP_001295493.1.63370 WP_001295493.1.63374 WP_001295493.1.63393 WP_001295493.1.63419 WP_001295493.1.63437 WP_001295493.1.63445 WP_001295493.1.63453 WP_001295493.1.63465 WP_001295493.1.63466 WP_001295493.1.63467 WP_001295493.1.63470 WP_001295493.1.63478 WP_001295493.1.6348 WP_001295493.1.63484 WP_001295493.1.63487 WP_001295493.1.63491 WP_001295493.1.63496 WP_001295493.1.63536 WP_001295493.1.63554 WP_001295493.1.63556 WP_001295493.1.63563 WP_001295493.1.63576 WP_001295493.1.63586 WP_001295493.1.63602 WP_001295493.1.63604 WP_001295493.1.63608 WP_001295493.1.63612 WP_001295493.1.63615 WP_001295493.1.6364 WP_001295493.1.63666 WP_001295493.1.63683 WP_001295493.1.63703 WP_001295493.1.63721 WP_001295493.1.63746 WP_001295493.1.63800 WP_001295493.1.63810 WP_001295493.1.63821 WP_001295493.1.63856 WP_001295493.1.63871 WP_001295493.1.63872 WP_001295493.1.63944 WP_001295493.1.63957 WP_001295493.1.63964 WP_001295493.1.63969 WP_001295493.1.63990 WP_001295493.1.64008 WP_001295493.1.64014 WP_001295493.1.64040 WP_001295493.1.64050 WP_001295493.1.64053 WP_001295493.1.64074 WP_001295493.1.64080 WP_001295493.1.64086 WP_001295493.1.64110 WP_001295493.1.64150 WP_001295493.1.64153 WP_001295493.1.6416 WP_001295493.1.64161 WP_001295493.1.64175 WP_001295493.1.64180 WP_001295493.1.64193 WP_001295493.1.64280 WP_001295493.1.64285 WP_001295493.1.64286 WP_001295493.1.643 WP_001295493.1.64321 WP_001295493.1.64337 WP_001295493.1.64353 WP_001295493.1.64356 WP_001295493.1.64371 WP_001295493.1.64380 WP_001295493.1.64391 WP_001295493.1.6441 WP_001295493.1.64417 WP_001295493.1.64437 WP_001295493.1.64438 WP_001295493.1.6444 WP_001295493.1.64448 WP_001295493.1.6445 WP_001295493.1.64458 WP_001295493.1.6446 WP_001295493.1.64519 WP_001295493.1.64520 WP_001295493.1.64528 WP_001295493.1.64540 WP_001295493.1.64547 WP_001295493.1.64563 WP_001295493.1.64621 WP_001295493.1.64634 WP_001295493.1.64657 WP_001295493.1.6469 WP_001295493.1.64693 WP_001295493.1.64695 WP_001295493.1.64707 WP_001295493.1.64746 WP_001295493.1.64749 WP_001295493.1.64784 WP_001295493.1.64789 WP_001295493.1.64793 WP_001295493.1.64821 WP_001295493.1.64840 WP_001295493.1.64866 WP_001295493.1.64881 WP_001295493.1.64895 WP_001295493.1.64901 WP_001295493.1.64912 WP_001295493.1.64926 WP_001295493.1.64930 WP_001295493.1.64939 WP_001295493.1.64946 WP_001295493.1.64970 WP_001295493.1.6499 WP_001295493.1.6500 WP_001295493.1.65023 WP_001295493.1.65035 WP_001295493.1.65040 WP_001295493.1.65056 WP_001295493.1.65084 WP_001295493.1.65097 WP_001295493.1.651 WP_001295493.1.65104 WP_001295493.1.6511 WP_001295493.1.65110 WP_001295493.1.65114 WP_001295493.1.65116 WP_001295493.1.65118 WP_001295493.1.65135 WP_001295493.1.65151 WP_001295493.1.65155 WP_001295493.1.6516 WP_001295493.1.65179 WP_001295493.1.65192 WP_001295493.1.65194 WP_001295493.1.65206 WP_001295493.1.65240 WP_001295493.1.65256 WP_001295493.1.6527 WP_001295493.1.65271 WP_001295493.1.65286 WP_001295493.1.65296 WP_001295493.1.65305 WP_001295493.1.65306 WP_001295493.1.65353 WP_001295493.1.65364 WP_001295493.1.65366 WP_001295493.1.6537 WP_001295493.1.65372 WP_001295493.1.654 WP_001295493.1.65408 WP_001295493.1.65413 WP_001295493.1.65456 WP_001295493.1.65484 WP_001295493.1.65493 WP_001295493.1.6553 WP_001295493.1.65531 WP_001295493.1.65546 WP_001295493.1.65565 WP_001295493.1.65581 WP_001295493.1.65596 WP_001295493.1.65606 WP_001295493.1.6563 WP_001295493.1.65662 WP_001295493.1.65667 WP_001295493.1.65672 WP_001295493.1.65677 WP_001295493.1.65708 WP_001295493.1.65714 WP_001295493.1.6576 WP_001295493.1.65762 WP_001295493.1.65834 WP_001295493.1.6587 WP_001295493.1.65875 WP_001295493.1.65898 WP_001295493.1.65954 WP_001295493.1.65957 WP_001295493.1.65961 WP_001295493.1.65962 WP_001295493.1.65963 WP_001295493.1.65976 WP_001295493.1.65978 WP_001295493.1.65988 WP_001295493.1.6599 WP_001295493.1.65991 WP_001295493.1.66001 WP_001295493.1.66007 WP_001295493.1.66016 WP_001295493.1.66017 WP_001295493.1.66033 WP_001295493.1.6604 WP_001295493.1.66044 WP_001295493.1.66050 WP_001295493.1.66059 WP_001295493.1.66094 WP_001295493.1.66100 WP_001295493.1.66102 WP_001295493.1.66104 WP_001295493.1.66105 WP_001295493.1.66121 WP_001295493.1.66127 WP_001295493.1.66161 WP_001295493.1.6618 WP_001295493.1.66181 WP_001295493.1.66187 WP_001295493.1.66197 WP_001295493.1.6622 WP_001295493.1.66251 WP_001295493.1.66264 WP_001295493.1.66280 WP_001295493.1.66288 WP_001295493.1.66290 WP_001295493.1.66295 WP_001295493.1.66335 WP_001295493.1.6635 WP_001295493.1.66376 WP_001295493.1.66387 WP_001295493.1.66389 WP_001295493.1.66392 WP_001295493.1.66395 WP_001295493.1.66412 WP_001295493.1.66432 WP_001295493.1.66448 WP_001295493.1.6645 WP_001295493.1.66511 WP_001295493.1.66523 WP_001295493.1.66531 WP_001295493.1.6654 WP_001295493.1.66550 WP_001295493.1.66559 WP_001295493.1.66566 WP_001295493.1.66579 WP_001295493.1.66624 WP_001295493.1.66644 WP_001295493.1.6665 WP_001295493.1.6666 WP_001295493.1.66700 WP_001295493.1.66706 WP_001295493.1.66708 WP_001295493.1.66719 WP_001295493.1.66727 WP_001295493.1.66758 WP_001295493.1.6676 WP_001295493.1.66783 WP_001295493.1.66787 WP_001295493.1.66791 WP_001295493.1.66794 WP_001295493.1.66795 WP_001295493.1.66796 WP_001295493.1.66849 WP_001295493.1.66873 WP_001295493.1.66922 WP_001295493.1.66926 WP_001295493.1.66933 WP_001295493.1.66948 WP_001295493.1.66975 WP_001295493.1.66978 WP_001295493.1.6698 WP_001295493.1.6701 WP_001295493.1.67018 WP_001295493.1.67021 WP_001295493.1.67022 WP_001295493.1.67026 WP_001295493.1.67029 WP_001295493.1.67035 WP_001295493.1.67047 WP_001295493.1.6706 WP_001295493.1.67073 WP_001295493.1.67102 WP_001295493.1.67116 WP_001295493.1.67120 WP_001295493.1.67132 WP_001295493.1.67136 WP_001295493.1.67137 WP_001295493.1.67149 WP_001295493.1.67150 WP_001295493.1.67153 WP_001295493.1.67158 WP_001295493.1.67164 WP_001295493.1.67174 WP_001295493.1.67193 WP_001295493.1.67194 WP_001295493.1.67200 WP_001295493.1.67209 WP_001295493.1.67210 WP_001295493.1.67214 WP_001295493.1.6723 WP_001295493.1.67258 WP_001295493.1.67272 WP_001295493.1.67293 WP_001295493.1.6735 WP_001295493.1.67383 WP_001295493.1.67412 WP_001295493.1.67415 WP_001295493.1.67427 WP_001295493.1.67446 WP_001295493.1.67451 WP_001295493.1.67452 WP_001295493.1.67454 WP_001295493.1.67462 WP_001295493.1.67464 WP_001295493.1.67467 WP_001295493.1.67468 WP_001295493.1.67522 WP_001295493.1.67533 WP_001295493.1.67538 WP_001295493.1.67549 WP_001295493.1.67553 WP_001295493.1.67581 WP_001295493.1.67590 WP_001295493.1.67606 WP_001295493.1.67660 WP_001295493.1.67663 WP_001295493.1.67669 WP_001295493.1.67676 WP_001295493.1.6769 WP_001295493.1.67690 WP_001295493.1.67701 WP_001295493.1.67704 WP_001295493.1.67724 WP_001295493.1.67726 WP_001295493.1.67732 WP_001295493.1.67737 WP_001295493.1.67753 WP_001295493.1.67760 WP_001295493.1.67775 WP_001295493.1.67780 WP_001295493.1.67786 WP_001295493.1.67787 WP_001295493.1.67788 WP_001295493.1.678 WP_001295493.1.67802 WP_001295493.1.67810 WP_001295493.1.67841 WP_001295493.1.67853 WP_001295493.1.67891 WP_001295493.1.67901 WP_001295493.1.6793 WP_001295493.1.67938 WP_001295493.1.67971 WP_001295493.1.67975 WP_001295493.1.67984 WP_001295493.1.67990 WP_001295493.1.67992 WP_001295493.1.67999 WP_001295493.1.68008 WP_001295493.1.68011 WP_001295493.1.68012 WP_001295493.1.6802 WP_001295493.1.68025 WP_001295493.1.6803 WP_001295493.1.68039 WP_001295493.1.68052 WP_001295493.1.68053 WP_001295493.1.68067 WP_001295493.1.68069 WP_001295493.1.68070 WP_001295493.1.68071 WP_001295493.1.68079 WP_001295493.1.68096 WP_001295493.1.68108 WP_001295493.1.68126 WP_001295493.1.68138 WP_001295493.1.6814 WP_001295493.1.68145 WP_001295493.1.68157 WP_001295493.1.68170 WP_001295493.1.68177 WP_001295493.1.682 WP_001295493.1.68200 WP_001295493.1.68215 WP_001295493.1.68241 WP_001295493.1.68255 WP_001295493.1.68271 WP_001295493.1.68279 WP_001295493.1.68281 WP_001295493.1.68283 WP_001295493.1.68300 WP_001295493.1.68336 WP_001295493.1.68341 WP_001295493.1.68347 WP_001295493.1.68362 WP_001295493.1.68369 WP_001295493.1.68395 WP_001295493.1.68396 WP_001295493.1.68411 WP_001295493.1.68442 WP_001295493.1.68482 WP_001295493.1.68490 WP_001295493.1.68493 WP_001295493.1.68523 WP_001295493.1.68524 WP_001295493.1.68534 WP_001295493.1.68566 WP_001295493.1.68572 WP_001295493.1.68584 WP_001295493.1.68598 WP_001295493.1.6860 WP_001295493.1.68609 WP_001295493.1.68630 WP_001295493.1.68632 WP_001295493.1.68635 WP_001295493.1.68673 WP_001295493.1.68678 WP_001295493.1.68679 WP_001295493.1.68695 WP_001295493.1.68697 WP_001295493.1.68701 WP_001295493.1.68711 WP_001295493.1.68731 WP_001295493.1.68750 WP_001295493.1.68751 WP_001295493.1.68752 WP_001295493.1.6877 WP_001295493.1.68795 WP_001295493.1.68797 WP_001295493.1.6880 WP_001295493.1.68801 WP_001295493.1.68838 WP_001295493.1.68847 WP_001295493.1.68865 WP_001295493.1.6887 WP_001295493.1.68873 WP_001295493.1.68880 WP_001295493.1.68915 WP_001295493.1.68924 WP_001295493.1.68936 WP_001295493.1.68942 WP_001295493.1.68956 WP_001295493.1.68961 WP_001295493.1.6897 WP_001295493.1.68989 WP_001295493.1.68995 WP_001295493.1.69033 WP_001295493.1.69039 WP_001295493.1.69054 WP_001295493.1.69098 WP_001295493.1.69126 WP_001295493.1.69127 WP_001295493.1.69144 WP_001295493.1.69158 WP_001295493.1.6916 WP_001295493.1.6919 WP_001295493.1.69192 WP_001295493.1.6921 WP_001295493.1.69221 WP_001295493.1.6923 WP_001295493.1.69247 WP_001295493.1.69258 WP_001295493.1.69261 WP_001295493.1.6929 WP_001295493.1.69303 WP_001295493.1.69305 WP_001295493.1.69341 WP_001295493.1.69350 WP_001295493.1.69351 WP_001295493.1.69382 WP_001295493.1.69390 WP_001295493.1.694 WP_001295493.1.69404 WP_001295493.1.69441 WP_001295493.1.6945 WP_001295493.1.69450 WP_001295493.1.69472 WP_001295493.1.69473 WP_001295493.1.69506 WP_001295493.1.69537 WP_001295493.1.69551 WP_001295493.1.69583 WP_001295493.1.69589 WP_001295493.1.69596 WP_001295493.1.69605 WP_001295493.1.69643 WP_001295493.1.69646 WP_001295493.1.69649 WP_001295493.1.69655 WP_001295493.1.69689 WP_001295493.1.697 WP_001295493.1.69716 WP_001295493.1.69730 WP_001295493.1.69735 WP_001295493.1.69780 WP_001295493.1.69786 WP_001295493.1.69803 WP_001295493.1.69810 WP_001295493.1.69818 WP_001295493.1.69831 WP_001295493.1.69832 WP_001295493.1.69868 WP_001295493.1.69887 WP_001295493.1.69896 WP_001295493.1.6993 WP_001295493.1.69963 WP_001295493.1.69972 WP_001295493.1.69979 WP_001295493.1.69999 WP_001295493.1.7001 WP_001295493.1.70041 WP_001295493.1.70063 WP_001295493.1.70081 WP_001295493.1.701 WP_001295493.1.70123 WP_001295493.1.70125 WP_001295493.1.7013 WP_001295493.1.70149 WP_001295493.1.7015 WP_001295493.1.70190 WP_001295493.1.70191 WP_001295493.1.70200 WP_001295493.1.70213 WP_001295493.1.70230 WP_001295493.1.70251 WP_001295493.1.70256 WP_001295493.1.70337 WP_001295493.1.70341 WP_001295493.1.70357 WP_001295493.1.70370 WP_001295493.1.70407 WP_001295493.1.70414 WP_001295493.1.70477 WP_001295493.1.70492 WP_001295493.1.7050 WP_001295493.1.70509 WP_001295493.1.70517 WP_001295493.1.7052 WP_001295493.1.70530 WP_001295493.1.70539 WP_001295493.1.70563 WP_001295493.1.70576 WP_001295493.1.70578 WP_001295493.1.70582 WP_001295493.1.70592 WP_001295493.1.70597 WP_001295493.1.70600 WP_001295493.1.70628 WP_001295493.1.70656 WP_001295493.1.70694 WP_001295493.1.70698 WP_001295493.1.70705 WP_001295493.1.70713 WP_001295493.1.70723 WP_001295493.1.70728 WP_001295493.1.70745 WP_001295493.1.70747 WP_001295493.1.70748 WP_001295493.1.70767 WP_001295493.1.70787 WP_001295493.1.70794 WP_001295493.1.70801 WP_001295493.1.70803 WP_001295493.1.70880 WP_001295493.1.70896 WP_001295493.1.7090 WP_001295493.1.70900 WP_001295493.1.70952 WP_001295493.1.70967 WP_001295493.1.71003 WP_001295493.1.71024 WP_001295493.1.71037 WP_001295493.1.71042 WP_001295493.1.71062 WP_001295493.1.71099 WP_001295493.1.71109 WP_001295493.1.71113 WP_001295493.1.71134 WP_001295493.1.71139 WP_001295493.1.71147 WP_001295493.1.71149 WP_001295493.1.71158 WP_001295493.1.71159 WP_001295493.1.71162 WP_001295493.1.71170 WP_001295493.1.71176 WP_001295493.1.71192 WP_001295493.1.71199 WP_001295493.1.71205 WP_001295493.1.7121 WP_001295493.1.71221 WP_001295493.1.71223 WP_001295493.1.71225 WP_001295493.1.71226 WP_001295493.1.71229 WP_001295493.1.71264 WP_001295493.1.71269 WP_001295493.1.71272 WP_001295493.1.71273 WP_001295493.1.71275 WP_001295493.1.71285 WP_001295493.1.71287 WP_001295493.1.71294 WP_001295493.1.71311 WP_001295493.1.71312 WP_001295493.1.71315 WP_001295493.1.71323 WP_001295493.1.71327 WP_001295493.1.71339 WP_001295493.1.71354 WP_001295493.1.71397 WP_001295493.1.71403 WP_001295493.1.71405 WP_001295493.1.71409 WP_001295493.1.71423 WP_001295493.1.71448 WP_001295493.1.7147 WP_001295493.1.71480 WP_001295493.1.71522 WP_001295493.1.71533 WP_001295493.1.71537 WP_001295493.1.71538 WP_001295493.1.71540 WP_001295493.1.71560 WP_001295493.1.71563 WP_001295493.1.71603 WP_001295493.1.71632 WP_001295493.1.71680 WP_001295493.1.71690 WP_001295493.1.71695 WP_001295493.1.71712 WP_001295493.1.71724 WP_001295493.1.71732 WP_001295493.1.71757 WP_001295493.1.71767 WP_001295493.1.71783 WP_001295493.1.71832 WP_001295493.1.71837 WP_001295493.1.71840 WP_001295493.1.71855 WP_001295493.1.71856 WP_001295493.1.71874 WP_001295493.1.7192 WP_001295493.1.71922 WP_001295493.1.71938 WP_001295493.1.71939 WP_001295493.1.71940 WP_001295493.1.71944 WP_001295493.1.71945 WP_001295493.1.71967 WP_001295493.1.71975 WP_001295493.1.71987 WP_001295493.1.71993 WP_001295493.1.72013 WP_001295493.1.72016 WP_001295493.1.72021 WP_001295493.1.72028 WP_001295493.1.72033 WP_001295493.1.7205 WP_001295493.1.72053 WP_001295493.1.72054 WP_001295493.1.72090 WP_001295493.1.7210 WP_001295493.1.72117 WP_001295493.1.72120 WP_001295493.1.72125 WP_001295493.1.72126 WP_001295493.1.72141 WP_001295493.1.72153 WP_001295493.1.72155 WP_001295493.1.72157 WP_001295493.1.72161 WP_001295493.1.72180 WP_001295493.1.72184 WP_001295493.1.72208 WP_001295493.1.72212 WP_001295493.1.72237 WP_001295493.1.72240 WP_001295493.1.72248 WP_001295493.1.7225 WP_001295493.1.72258 WP_001295493.1.72261 WP_001295493.1.72262 WP_001295493.1.72270 WP_001295493.1.72279 WP_001295493.1.72290 WP_001295493.1.72293 WP_001295493.1.723 WP_001295493.1.72322 WP_001295493.1.72337 WP_001295493.1.72342 WP_001295493.1.72359 WP_001295493.1.72362 WP_001295493.1.72388 WP_001295493.1.72391 WP_001295493.1.72392 WP_001295493.1.72397 WP_001295493.1.72414 WP_001295493.1.72425 WP_001295493.1.72427 WP_001295493.1.72431 WP_001295493.1.72436 WP_001295493.1.72449 WP_001295493.1.72469 WP_001295493.1.72485 WP_001295493.1.72493 WP_001295493.1.72507 WP_001295493.1.72511 WP_001295493.1.72521 WP_001295493.1.72522 WP_001295493.1.72535 WP_001295493.1.72537 WP_001295493.1.72544 WP_001295493.1.72574 WP_001295493.1.72582 WP_001295493.1.72593 WP_001295493.1.72599 WP_001295493.1.72606 WP_001295493.1.72608 WP_001295493.1.72614 WP_001295493.1.72615 WP_001295493.1.72616 WP_001295493.1.72619 WP_001295493.1.72641 WP_001295493.1.72643 WP_001295493.1.72651 WP_001295493.1.72652 WP_001295493.1.72663 WP_001295493.1.72694 WP_001295493.1.72695 WP_001295493.1.72698 WP_001295493.1.72700 WP_001295493.1.72725 WP_001295493.1.72729 WP_001295493.1.72738 WP_001295493.1.72745 WP_001295493.1.72747 WP_001295493.1.72748 WP_001295493.1.72751 WP_001295493.1.72758 WP_001295493.1.72764 WP_001295493.1.7277 WP_001295493.1.72778 WP_001295493.1.72804 WP_001295493.1.72806 WP_001295493.1.7281 WP_001295493.1.72837 WP_001295493.1.72857 WP_001295493.1.72858 WP_001295493.1.72860 WP_001295493.1.72869 WP_001295493.1.72893 WP_001295493.1.7291 WP_001295493.1.72910 WP_001295493.1.72913 WP_001295493.1.72947 WP_001295493.1.72956 WP_001295493.1.72962 WP_001295493.1.72998 WP_001295493.1.73000 WP_001295493.1.73010 WP_001295493.1.73015 WP_001295493.1.73032 WP_001295493.1.73061 WP_001295493.1.7307 WP_001295493.1.73072 WP_001295493.1.73075 WP_001295493.1.73085 WP_001295493.1.73126 WP_001295493.1.73129 WP_001295493.1.73193 WP_001295493.1.73197 WP_001295493.1.73215 WP_001295493.1.73217 WP_001295493.1.73230 WP_001295493.1.73239 WP_001295493.1.73243 WP_001295493.1.73249 WP_001295493.1.73251 WP_001295493.1.73257 WP_001295493.1.73259 WP_001295493.1.73277 WP_001295493.1.73278 WP_001295493.1.73283 WP_001295493.1.73291 WP_001295493.1.73292 WP_001295493.1.73295 WP_001295493.1.73326 WP_001295493.1.73333 WP_001295493.1.73340 WP_001295493.1.73343 WP_001295493.1.73344 WP_001295493.1.73349 WP_001295493.1.73385 WP_001295493.1.73428 WP_001295493.1.73430 WP_001295493.1.7345 WP_001295493.1.73468 WP_001295493.1.73486 WP_001295493.1.7349 WP_001295493.1.73498 WP_001295493.1.73524 WP_001295493.1.73565 WP_001295493.1.73572 WP_001295493.1.73592 WP_001295493.1.73604 WP_001295493.1.73626 WP_001295493.1.73631 WP_001295493.1.73652 WP_001295493.1.73663 WP_001295493.1.73700 WP_001295493.1.73709 WP_001295493.1.73717 WP_001295493.1.73743 WP_001295493.1.7376 WP_001295493.1.73785 WP_001295493.1.73797 WP_001295493.1.73801 WP_001295493.1.73807 WP_001295493.1.73811 WP_001295493.1.73827 WP_001295493.1.73835 WP_001295493.1.73843 WP_001295493.1.73844 WP_001295493.1.73846 WP_001295493.1.73859 WP_001295493.1.73882 WP_001295493.1.73897 WP_001295493.1.73908 WP_001295493.1.7392 WP_001295493.1.73934 WP_001295493.1.73942 WP_001295493.1.73968 WP_001295493.1.73980 WP_001295493.1.73992 WP_001295493.1.73995 WP_001295493.1.73996 WP_001295493.1.74032 WP_001295493.1.74041 WP_001295493.1.74045 WP_001295493.1.74046 WP_001295493.1.74051 WP_001295493.1.74053 WP_001295493.1.7411 WP_001295493.1.74123 WP_001295493.1.7413 WP_001295493.1.74156 WP_001295493.1.74213 WP_001295493.1.74223 WP_001295493.1.7424 WP_001295493.1.74243 WP_001295493.1.7425 WP_001295493.1.74251 WP_001295493.1.7429 WP_001295493.1.74294 WP_001295493.1.74309 WP_001295493.1.74365 WP_001295493.1.74367 WP_001295493.1.74423 WP_001295493.1.74431 WP_001295493.1.74444 WP_001295493.1.74445 WP_001295493.1.7446 WP_001295493.1.74465 WP_001295493.1.74478 WP_001295493.1.74491 WP_001295493.1.74501 WP_001295493.1.74509 WP_001295493.1.74513 WP_001295493.1.74520 WP_001295493.1.74521 WP_001295493.1.74528 WP_001295493.1.74532 WP_001295493.1.74536 WP_001295493.1.74549 WP_001295493.1.74557 WP_001295493.1.74574 WP_001295493.1.7461 WP_001295493.1.74624 WP_001295493.1.74625 WP_001295493.1.74652 WP_001295493.1.74670 WP_001295493.1.74687 WP_001295493.1.74688 WP_001295493.1.74689 WP_001295493.1.74691 WP_001295493.1.74705 WP_001295493.1.7471 WP_001295493.1.74713 WP_001295493.1.74716 WP_001295493.1.74720 WP_001295493.1.74735 WP_001295493.1.7475 WP_001295493.1.74752 WP_001295493.1.74765 WP_001295493.1.7478 WP_001295493.1.7479 WP_001295493.1.74793 WP_001295493.1.74811 WP_001295493.1.74828 WP_001295493.1.74844 WP_001295493.1.74852 WP_001295493.1.74854 WP_001295493.1.74860 WP_001295493.1.74867 WP_001295493.1.74873 WP_001295493.1.74879 WP_001295493.1.74880 WP_001295493.1.74885 WP_001295493.1.74895 WP_001295493.1.74904 WP_001295493.1.74914 WP_001295493.1.74915 WP_001295493.1.74962 WP_001295493.1.74975 WP_001295493.1.74993 WP_001295493.1.74998 WP_001295493.1.75003 WP_001295493.1.75021 WP_001295493.1.75029 WP_001295493.1.75030 WP_001295493.1.75050 WP_001295493.1.75100 WP_001295493.1.75112 WP_001295493.1.75118 WP_001295493.1.75124 WP_001295493.1.75136 WP_001295493.1.75138 WP_001295493.1.75139 WP_001295493.1.75143 WP_001295493.1.75145 WP_001295493.1.75149 WP_001295493.1.7516 WP_001295493.1.75181 WP_001295493.1.75209 WP_001295493.1.75218 WP_001295493.1.75219 WP_001295493.1.75221 WP_001295493.1.75228 WP_001295493.1.75243 WP_001295493.1.75247 WP_001295493.1.75248 WP_001295493.1.75254 WP_001295493.1.75270 WP_001295493.1.75272 WP_001295493.1.75306 WP_001295493.1.7536 WP_001295493.1.75360 WP_001295493.1.75367 WP_001295493.1.75382 WP_001295493.1.7539 WP_001295493.1.75419 WP_001295493.1.75428 WP_001295493.1.75435 WP_001295493.1.75465 WP_001295493.1.75491 WP_001295493.1.75505 WP_001295493.1.75507 WP_001295493.1.75515 WP_001295493.1.75529 WP_001295493.1.75536 WP_001295493.1.75537 WP_001295493.1.75557 WP_001295493.1.75568 WP_001295493.1.75577 WP_001295493.1.75588 WP_001295493.1.75594 WP_001295493.1.75602 WP_001295493.1.75612 WP_001295493.1.75629 WP_001295493.1.75644 WP_001295493.1.75653 WP_001295493.1.75672 WP_001295493.1.75676 WP_001295493.1.75679 WP_001295493.1.75687 WP_001295493.1.75694 WP_001295493.1.75696 WP_001295493.1.75698 WP_001295493.1.75699 WP_001295493.1.75725 WP_001295493.1.75735 WP_001295493.1.75758 WP_001295493.1.75767 WP_001295493.1.75786 WP_001295493.1.75803 WP_001295493.1.75808 WP_001295493.1.7583 WP_001295493.1.75853 WP_001295493.1.75892 WP_001295493.1.75918 WP_001295493.1.75922 WP_001295493.1.7597 WP_001295493.1.75973 WP_001295493.1.75983 WP_001295493.1.75989 WP_001295493.1.75999 WP_001295493.1.76005 WP_001295493.1.76009 WP_001295493.1.76019 WP_001295493.1.7603 WP_001295493.1.76030 WP_001295493.1.76036 WP_001295493.1.76039 WP_001295493.1.76054 WP_001295493.1.7608 WP_001295493.1.76087 WP_001295493.1.76089 WP_001295493.1.76103 WP_001295493.1.76118 WP_001295493.1.76119 WP_001295493.1.76129 WP_001295493.1.7613 WP_001295493.1.76152 WP_001295493.1.76189 WP_001295493.1.76196 WP_001295493.1.76211 WP_001295493.1.76237 WP_001295493.1.76268 WP_001295493.1.76269 WP_001295493.1.76305 WP_001295493.1.76312 WP_001295493.1.76325 WP_001295493.1.76361 WP_001295493.1.7637 WP_001295493.1.76384 WP_001295493.1.76387 WP_001295493.1.76390 WP_001295493.1.76407 WP_001295493.1.76446 WP_001295493.1.76447 WP_001295493.1.76448 WP_001295493.1.76452 WP_001295493.1.76460 WP_001295493.1.76462 WP_001295493.1.76466 WP_001295493.1.76477 WP_001295493.1.76504 WP_001295493.1.76542 WP_001295493.1.76544 WP_001295493.1.76547 WP_001295493.1.76562 WP_001295493.1.76596 WP_001295493.1.7661 WP_001295493.1.76612 WP_001295493.1.76619 WP_001295493.1.76643 WP_001295493.1.76656 WP_001295493.1.76660 WP_001295493.1.76697 WP_001295493.1.76701 WP_001295493.1.76705 WP_001295493.1.76707 WP_001295493.1.76712 WP_001295493.1.76751 WP_001295493.1.76815 WP_001295493.1.76827 WP_001295493.1.76831 WP_001295493.1.76840 WP_001295493.1.76863 WP_001295493.1.76884 WP_001295493.1.7689 WP_001295493.1.76909 WP_001295493.1.76918 WP_001295493.1.76933 WP_001295493.1.76957 WP_001295493.1.76961 WP_001295493.1.76966 WP_001295493.1.7699 WP_001295493.1.77022 WP_001295493.1.77036 WP_001295493.1.77057 WP_001295493.1.77070 WP_001295493.1.77099 WP_001295493.1.771 WP_001295493.1.77109 WP_001295493.1.77120 WP_001295493.1.77128 WP_001295493.1.77134 WP_001295493.1.77147 WP_001295493.1.77162 WP_001295493.1.77163 WP_001295493.1.77173 WP_001295493.1.77175 WP_001295493.1.77198 WP_001295493.1.77200 WP_001295493.1.77204 WP_001295493.1.77214 WP_001295493.1.77224 WP_001295493.1.77239 WP_001295493.1.77255 WP_001295493.1.77258 WP_001295493.1.77275 WP_001295493.1.7728 WP_001295493.1.77288 WP_001295493.1.77290 WP_001295493.1.77291 WP_001295493.1.77296 WP_001295493.1.7731 WP_001295493.1.77326 WP_001295493.1.77341 WP_001295493.1.77358 WP_001295493.1.77391 WP_001295493.1.77392 WP_001295493.1.77408 WP_001295493.1.77419 WP_001295493.1.77437 WP_001295493.1.77448 WP_001295493.1.77452 WP_001295493.1.77455 WP_001295493.1.77462 WP_001295493.1.77470 WP_001295493.1.77471 WP_001295493.1.77477 WP_001295493.1.77487 WP_001295493.1.77495 WP_001295493.1.775 WP_001295493.1.77503 WP_001295493.1.77542 WP_001295493.1.77551 WP_001295493.1.77577 WP_001295493.1.77581 WP_001295493.1.77595 WP_001295493.1.77600 WP_001295493.1.77608 WP_001295493.1.77626 WP_001295493.1.77632 WP_001295493.1.77636 WP_001295493.1.77643 WP_001295493.1.77644 WP_001295493.1.77648 WP_001295493.1.77707 WP_001295493.1.77725 WP_001295493.1.77741 WP_001295493.1.7775 WP_001295493.1.77760 WP_001295493.1.77767 WP_001295493.1.77768 WP_001295493.1.7780 WP_001295493.1.7781 WP_001295493.1.77816 WP_001295493.1.77826 WP_001295493.1.77833 WP_001295493.1.77876 WP_001295493.1.77929 WP_001295493.1.77949 WP_001295493.1.7795 WP_001295493.1.77950 WP_001295493.1.77961 WP_001295493.1.77979 WP_001295493.1.7799 WP_001295493.1.77999 WP_001295493.1.78000 WP_001295493.1.78007 WP_001295493.1.78010 WP_001295493.1.78041 WP_001295493.1.78059 WP_001295493.1.7806 WP_001295493.1.7808 WP_001295493.1.78089 WP_001295493.1.78097 WP_001295493.1.78099 WP_001295493.1.78101 WP_001295493.1.78102 WP_001295493.1.78196 WP_001295493.1.78202 WP_001295493.1.78232 WP_001295493.1.78233 WP_001295493.1.78235 WP_001295493.1.78297 WP_001295493.1.78305 WP_001295493.1.78321 WP_001295493.1.78337 WP_001295493.1.78340 WP_001295493.1.78376 WP_001295493.1.78377 WP_001295493.1.78390 WP_001295493.1.784 WP_001295493.1.78413 WP_001295493.1.78445 WP_001295493.1.78462 WP_001295493.1.78463 WP_001295493.1.7847 WP_001295493.1.78477 WP_001295493.1.78481 WP_001295493.1.78491 WP_001295493.1.7851 WP_001295493.1.78512 WP_001295493.1.78515 WP_001295493.1.78527 WP_001295493.1.7855 WP_001295493.1.78553 WP_001295493.1.78572 WP_001295493.1.78575 WP_001295493.1.78581 WP_001295493.1.78583 WP_001295493.1.78586 WP_001295493.1.78593 WP_001295493.1.78610 WP_001295493.1.78611 WP_001295493.1.78612 WP_001295493.1.78615 WP_001295493.1.78645 WP_001295493.1.78677 WP_001295493.1.78683 WP_001295493.1.78687 WP_001295493.1.78689 WP_001295493.1.78696 WP_001295493.1.78698 WP_001295493.1.78718 WP_001295493.1.78746 WP_001295493.1.78750 WP_001295493.1.78757 WP_001295493.1.78773 WP_001295493.1.78775 WP_001295493.1.78791 WP_001295493.1.78814 WP_001295493.1.7883 WP_001295493.1.78843 WP_001295493.1.78845 WP_001295493.1.78854 WP_001295493.1.78888 WP_001295493.1.78891 WP_001295493.1.78893 WP_001295493.1.78895 WP_001295493.1.78908 WP_001295493.1.78919 WP_001295493.1.78953 WP_001295493.1.78956 WP_001295493.1.7896 WP_001295493.1.78966 WP_001295493.1.7898 WP_001295493.1.78996 WP_001295493.1.79001 WP_001295493.1.79002 WP_001295493.1.79004 WP_001295493.1.7901 WP_001295493.1.79065 WP_001295493.1.79067 WP_001295493.1.79075 WP_001295493.1.79086 WP_001295493.1.79088 WP_001295493.1.79090 WP_001295493.1.79092 WP_001295493.1.79100 WP_001295493.1.79126 WP_001295493.1.79159 WP_001295493.1.79172 WP_001295493.1.79226 WP_001295493.1.79233 WP_001295493.1.79243 WP_001295493.1.79246 WP_001295493.1.79248 WP_001295493.1.79249 WP_001295493.1.79276 WP_001295493.1.79308 WP_001295493.1.79312 WP_001295493.1.79343 WP_001295493.1.79346 WP_001295493.1.79348 WP_001295493.1.79356 WP_001295493.1.79365 WP_001295493.1.79369 WP_001295493.1.7937 WP_001295493.1.79389 WP_001295493.1.79391 WP_001295493.1.7940 WP_001295493.1.79409 WP_001295493.1.79416 WP_001295493.1.79443 WP_001295493.1.79464 WP_001295493.1.79505 WP_001295493.1.79519 WP_001295493.1.7952 WP_001295493.1.79525 WP_001295493.1.79526 WP_001295493.1.79528 WP_001295493.1.79540 WP_001295493.1.79558 WP_001295493.1.79563 WP_001295493.1.79576 WP_001295493.1.79591 WP_001295493.1.79606 WP_001295493.1.79619 WP_001295493.1.79640 WP_001295493.1.7967 WP_001295493.1.79685 WP_001295493.1.79713 WP_001295493.1.79715 WP_001295493.1.79749 WP_001295493.1.79759 WP_001295493.1.79764 WP_001295493.1.79800 WP_001295493.1.79816 WP_001295493.1.79824 WP_001295493.1.79840 WP_001295493.1.7985 WP_001295493.1.79866 WP_001295493.1.79869 WP_001295493.1.7987 WP_001295493.1.79871 WP_001295493.1.79877 WP_001295493.1.79905 WP_001295493.1.79922 WP_001295493.1.7993 WP_001295493.1.79930 WP_001295493.1.79931 WP_001295493.1.79932 WP_001295493.1.79933 WP_001295493.1.79936 WP_001295493.1.79944 WP_001295493.1.79952 WP_001295493.1.79955 WP_001295493.1.79965 WP_001295493.1.79973 WP_001295493.1.79984 WP_001295493.1.79995 WP_001295493.1.80 WP_001295493.1.80011 WP_001295493.1.80026 WP_001295493.1.8004 WP_001295493.1.80043 WP_001295493.1.80050 WP_001295493.1.80060 WP_001295493.1.80063 WP_001295493.1.8007 WP_001295493.1.80071 WP_001295493.1.80096 WP_001295493.1.80106 WP_001295493.1.80112 WP_001295493.1.80136 WP_001295493.1.80141 WP_001295493.1.80176 WP_001295493.1.80179 WP_001295493.1.80183 WP_001295493.1.80192 WP_001295493.1.80255 WP_001295493.1.80292 WP_001295493.1.80309 WP_001295493.1.80320 WP_001295493.1.80330 WP_001295493.1.80388 WP_001295493.1.80392 WP_001295493.1.80402 WP_001295493.1.80426 WP_001295493.1.80428 WP_001295493.1.80440 WP_001295493.1.80444 WP_001295493.1.80456 WP_001295493.1.80463 WP_001295493.1.80484 WP_001295493.1.80517 WP_001295493.1.80519 WP_001295493.1.80524 WP_001295493.1.80545 WP_001295493.1.80559 WP_001295493.1.8057 WP_001295493.1.80578 WP_001295493.1.80594 WP_001295493.1.80606 WP_001295493.1.80612 WP_001295493.1.80626 WP_001295493.1.80660 WP_001295493.1.80662 WP_001295493.1.80666 WP_001295493.1.80676 WP_001295493.1.8068 WP_001295493.1.80709 WP_001295493.1.80718 WP_001295493.1.80731 WP_001295493.1.80736 WP_001295493.1.80737 WP_001295493.1.8074 WP_001295493.1.80753 WP_001295493.1.80754 WP_001295493.1.80756 WP_001295493.1.8076 WP_001295493.1.80768 WP_001295493.1.80789 WP_001295493.1.808 WP_001295493.1.80804 WP_001295493.1.80805 WP_001295493.1.80843 WP_001295493.1.80862 WP_001295493.1.80882 WP_001295493.1.80884 WP_001295493.1.80894 WP_001295493.1.8090 WP_001295493.1.8091 WP_001295493.1.80935 WP_001295493.1.80945 WP_001295493.1.80946 WP_001295493.1.80948 WP_001295493.1.80954 WP_001295493.1.80966 WP_001295493.1.80983 WP_001295493.1.80985 WP_001295493.1.810 WP_001295493.1.81026 WP_001295493.1.81032 WP_001295493.1.81034 WP_001295493.1.81036 WP_001295493.1.81054 WP_001295493.1.81056 WP_001295493.1.81070 WP_001295493.1.81071 WP_001295493.1.81098 WP_001295493.1.811 WP_001295493.1.81104 WP_001295493.1.81120 WP_001295493.1.81127 WP_001295493.1.81141 WP_001295493.1.81156 WP_001295493.1.81160 WP_001295493.1.81165 WP_001295493.1.8118 WP_001295493.1.81180 WP_001295493.1.81182 WP_001295493.1.8121 WP_001295493.1.81219 WP_001295493.1.81266 WP_001295493.1.81267 WP_001295493.1.81273 WP_001295493.1.81281 WP_001295493.1.81283 WP_001295493.1.81286 WP_001295493.1.8129 WP_001295493.1.81298 WP_001295493.1.81313 WP_001295493.1.81316 WP_001295493.1.81323 WP_001295493.1.81376 WP_001295493.1.81391 WP_001295493.1.814 WP_001295493.1.81420 WP_001295493.1.81423 WP_001295493.1.81438 WP_001295493.1.81442 WP_001295493.1.81469 WP_001295493.1.81475 WP_001295493.1.81484 WP_001295493.1.81514 WP_001295493.1.81517 WP_001295493.1.8156 WP_001295493.1.81576 WP_001295493.1.81577 WP_001295493.1.81580 WP_001295493.1.81582 WP_001295493.1.81588 WP_001295493.1.81589 WP_001295493.1.81596 WP_001295493.1.81602 WP_001295493.1.81618 WP_001295493.1.81625 WP_001295493.1.81688 WP_001295493.1.81692 WP_001295493.1.81715 WP_001295493.1.8172 WP_001295493.1.81723 WP_001295493.1.81754 WP_001295493.1.81806 WP_001295493.1.81819 WP_001295493.1.81821 WP_001295493.1.8183 WP_001295493.1.81832 WP_001295493.1.81843 WP_001295493.1.81869 WP_001295493.1.81873 WP_001295493.1.81876 WP_001295493.1.81881 WP_001295493.1.81914 WP_001295493.1.81934 WP_001295493.1.81935 WP_001295493.1.81939 WP_001295493.1.81952 WP_001295493.1.81956 WP_001295493.1.81972 WP_001295493.1.81975 WP_001295493.1.82 WP_001295493.1.82008 WP_001295493.1.82010 WP_001295493.1.82032 WP_001295493.1.82057 WP_001295493.1.82059 WP_001295493.1.82061 WP_001295493.1.82074 WP_001295493.1.82095 WP_001295493.1.82104 WP_001295493.1.82106 WP_001295493.1.82116 WP_001295493.1.82123 WP_001295493.1.82137 WP_001295493.1.82217 WP_001295493.1.82221 WP_001295493.1.82239 WP_001295493.1.82240 WP_001295493.1.82242 WP_001295493.1.82246 WP_001295493.1.82275 WP_001295493.1.82280 WP_001295493.1.82296 WP_001295493.1.82316 WP_001295493.1.82320 WP_001295493.1.82326 WP_001295493.1.82330 WP_001295493.1.8235 WP_001295493.1.82378 WP_001295493.1.82438 WP_001295493.1.82439 WP_001295493.1.82485 WP_001295493.1.82499 WP_001295493.1.82507 WP_001295493.1.82514 WP_001295493.1.82536 WP_001295493.1.82539 WP_001295493.1.8255 WP_001295493.1.82572 WP_001295493.1.82594 WP_001295493.1.82614 WP_001295493.1.82626 WP_001295493.1.82629 WP_001295493.1.82647 WP_001295493.1.82661 WP_001295493.1.8268 WP_001295493.1.82682 WP_001295493.1.82691 WP_001295493.1.82698 WP_001295493.1.82700 WP_001295493.1.82705 WP_001295493.1.82711 WP_001295493.1.82715 WP_001295493.1.82718 WP_001295493.1.82747 WP_001295493.1.82754 WP_001295493.1.8277 WP_001295493.1.82776 WP_001295493.1.82780 WP_001295493.1.82784 WP_001295493.1.82797 WP_001295493.1.82799 WP_001295493.1.82808 WP_001295493.1.82816 WP_001295493.1.82820 WP_001295493.1.82831 WP_001295493.1.82853 WP_001295493.1.82902 WP_001295493.1.82923 WP_001295493.1.8295 WP_001295493.1.83020 WP_001295493.1.83033 WP_001295493.1.83035 WP_001295493.1.83051 WP_001295493.1.83059 WP_001295493.1.8306 WP_001295493.1.8308 WP_001295493.1.83093 WP_001295493.1.83097 WP_001295493.1.83099 WP_001295493.1.831 WP_001295493.1.83118 WP_001295493.1.83125 WP_001295493.1.83127 WP_001295493.1.83140 WP_001295493.1.83151 WP_001295493.1.83160 WP_001295493.1.83177 WP_001295493.1.83205 WP_001295493.1.83214 WP_001295493.1.83224 WP_001295493.1.83253 WP_001295493.1.83256 WP_001295493.1.83286 WP_001295493.1.83330 WP_001295493.1.83340 WP_001295493.1.83347 WP_001295493.1.83375 WP_001295493.1.83415 WP_001295493.1.8345 WP_001295493.1.83466 WP_001295493.1.83481 WP_001295493.1.83537 WP_001295493.1.83544 WP_001295493.1.83564 WP_001295493.1.83584 WP_001295493.1.83644 WP_001295493.1.83660 WP_001295493.1.83684 WP_001295493.1.83706 WP_001295493.1.83712 WP_001295493.1.83735 WP_001295493.1.83762 WP_001295493.1.83781 WP_001295493.1.83807 WP_001295493.1.83820 WP_001295493.1.8384 WP_001295493.1.83941 WP_001295493.1.83947 WP_001295493.1.84004 WP_001295493.1.84014 WP_001295493.1.8405 WP_001295493.1.84059 WP_001295493.1.84060 WP_001295493.1.84074 WP_001295493.1.8411 WP_001295493.1.84140 WP_001295493.1.84164 WP_001295493.1.84172 WP_001295493.1.84185 WP_001295493.1.84210 WP_001295493.1.84215 WP_001295493.1.84219 WP_001295493.1.84221 WP_001295493.1.84264 WP_001295493.1.84298 WP_001295493.1.84312 WP_001295493.1.84316 WP_001295493.1.84319 WP_001295493.1.84331 WP_001295493.1.84339 WP_001295493.1.84348 WP_001295493.1.84402 WP_001295493.1.84405 WP_001295493.1.84410 WP_001295493.1.84436 WP_001295493.1.8444 WP_001295493.1.84462 WP_001295493.1.84464 WP_001295493.1.84467 WP_001295493.1.8447 WP_001295493.1.84473 WP_001295493.1.84476 WP_001295493.1.84482 WP_001295493.1.84484 WP_001295493.1.84486 WP_001295493.1.84511 WP_001295493.1.84518 WP_001295493.1.84531 WP_001295493.1.84534 WP_001295493.1.84584 WP_001295493.1.84635 WP_001295493.1.84639 WP_001295493.1.84656 WP_001295493.1.84657 WP_001295493.1.84668 WP_001295493.1.84675 WP_001295493.1.84697 WP_001295493.1.8470 WP_001295493.1.84731 WP_001295493.1.84738 WP_001295493.1.84740 WP_001295493.1.84768 WP_001295493.1.8477 WP_001295493.1.84784 WP_001295493.1.84797 WP_001295493.1.84841 WP_001295493.1.84850 WP_001295493.1.84875 WP_001295493.1.84878 WP_001295493.1.84881 WP_001295493.1.84893 WP_001295493.1.84894 WP_001295493.1.84916 WP_001295493.1.84929 WP_001295493.1.84941 WP_001295493.1.84948 WP_001295493.1.84966 WP_001295493.1.84972 WP_001295493.1.84977 WP_001295493.1.84986 WP_001295493.1.84989 WP_001295493.1.84990 WP_001295493.1.84994 WP_001295493.1.85002 WP_001295493.1.85008 WP_001295493.1.85011 WP_001295493.1.85025 WP_001295493.1.85052 WP_001295493.1.85085 WP_001295493.1.85090 WP_001295493.1.85098 WP_001295493.1.85105 WP_001295493.1.85106 WP_001295493.1.85112 WP_001295493.1.85129 WP_001295493.1.85138 WP_001295493.1.85141 WP_001295493.1.85155 WP_001295493.1.85156 WP_001295493.1.85175 WP_001295493.1.85188 WP_001295493.1.85216 WP_001295493.1.85241 WP_001295493.1.85247 WP_001295493.1.85252 WP_001295493.1.85253 WP_001295493.1.85255 WP_001295493.1.85260 WP_001295493.1.8530 WP_001295493.1.85305 WP_001295493.1.85310 WP_001295493.1.85315 WP_001295493.1.85323 WP_001295493.1.85329 WP_001295493.1.85335 WP_001295493.1.85342 WP_001295493.1.85361 WP_001295493.1.85369 WP_001295493.1.85385 WP_001295493.1.85416 WP_001295493.1.85435 WP_001295493.1.85500 WP_001295493.1.85504 WP_001295493.1.85525 WP_001295493.1.85546 WP_001295493.1.85554 WP_001295493.1.85556 WP_001295493.1.85558 WP_001295493.1.85563 WP_001295493.1.85578 WP_001295493.1.85593 WP_001295493.1.8560 WP_001295493.1.85601 WP_001295493.1.85621 WP_001295493.1.85623 WP_001295493.1.8564 WP_001295493.1.85657 WP_001295493.1.85685 WP_001295493.1.85722 WP_001295493.1.85752 WP_001295493.1.85762 WP_001295493.1.85767 WP_001295493.1.85772 WP_001295493.1.85773 WP_001295493.1.8579 WP_001295493.1.85793 WP_001295493.1.85800 WP_001295493.1.85806 WP_001295493.1.85857 WP_001295493.1.85895 WP_001295493.1.8592 WP_001295493.1.85939 WP_001295493.1.85944 WP_001295493.1.85969 WP_001295493.1.86 WP_001295493.1.86001 WP_001295493.1.86016 WP_001295493.1.8603 WP_001295493.1.86035 WP_001295493.1.86063 WP_001295493.1.8607 WP_001295493.1.86104 WP_001295493.1.86105 WP_001295493.1.86110 WP_001295493.1.86115 WP_001295493.1.86145 WP_001295493.1.86149 WP_001295493.1.86161 WP_001295493.1.86166 WP_001295493.1.86176 WP_001295493.1.86179 WP_001295493.1.86181 WP_001295493.1.86189 WP_001295493.1.8621 WP_001295493.1.86210 WP_001295493.1.86225 WP_001295493.1.86227 WP_001295493.1.86228 WP_001295493.1.86234 WP_001295493.1.86255 WP_001295493.1.86261 WP_001295493.1.86263 WP_001295493.1.86266 WP_001295493.1.86273 WP_001295493.1.86276 WP_001295493.1.86280 WP_001295493.1.86283 WP_001295493.1.86307 WP_001295493.1.86340 WP_001295493.1.8635 WP_001295493.1.86355 WP_001295493.1.86364 WP_001295493.1.86371 WP_001295493.1.86376 WP_001295493.1.86393 WP_001295493.1.86411 WP_001295493.1.86412 WP_001295493.1.86437 WP_001295493.1.86451 WP_001295493.1.86452 WP_001295493.1.86454 WP_001295493.1.86461 WP_001295493.1.86475 WP_001295493.1.86483 WP_001295493.1.86492 WP_001295493.1.86518 WP_001295493.1.8652 WP_001295493.1.8656 WP_001295493.1.86560 WP_001295493.1.86574 WP_001295493.1.86583 WP_001295493.1.86598 WP_001295493.1.86609 WP_001295493.1.86613 WP_001295493.1.86617 WP_001295493.1.86640 WP_001295493.1.86667 WP_001295493.1.86673 WP_001295493.1.86674 WP_001295493.1.86681 WP_001295493.1.86707 WP_001295493.1.86717 WP_001295493.1.86727 WP_001295493.1.86734 WP_001295493.1.86760 WP_001295493.1.86768 WP_001295493.1.86787 WP_001295493.1.86788 WP_001295493.1.8679 WP_001295493.1.86833 WP_001295493.1.86846 WP_001295493.1.86848 WP_001295493.1.8687 WP_001295493.1.86935 WP_001295493.1.86956 WP_001295493.1.86959 WP_001295493.1.86975 WP_001295493.1.86994 WP_001295493.1.86997 WP_001295493.1.87043 WP_001295493.1.87059 WP_001295493.1.87074 WP_001295493.1.87075 WP_001295493.1.87076 WP_001295493.1.87109 WP_001295493.1.8711 WP_001295493.1.87147 WP_001295493.1.87177 WP_001295493.1.87189 WP_001295493.1.87199 WP_001295493.1.87247 WP_001295493.1.87249 WP_001295493.1.87254 WP_001295493.1.87310 WP_001295493.1.87339 WP_001295493.1.87358 WP_001295493.1.87371 WP_001295493.1.87382 WP_001295493.1.87389 WP_001295493.1.87400 WP_001295493.1.87410 WP_001295493.1.87443 WP_001295493.1.87465 WP_001295493.1.87491 WP_001295493.1.87557 WP_001295493.1.87563 WP_001295493.1.87568 WP_001295493.1.87574 WP_001295493.1.87581 WP_001295493.1.87607 WP_001295493.1.87608 WP_001295493.1.87610 WP_001295493.1.87616 WP_001295493.1.87633 WP_001295493.1.87635 WP_001295493.1.87639 WP_001295493.1.87655 WP_001295493.1.87694 WP_001295493.1.87696 WP_001295493.1.8771 WP_001295493.1.87721 WP_001295493.1.87726 WP_001295493.1.87728 WP_001295493.1.87738 WP_001295493.1.87766 WP_001295493.1.8778 WP_001295493.1.87786 WP_001295493.1.87788 WP_001295493.1.87789 WP_001295493.1.87822 WP_001295493.1.87834 WP_001295493.1.87857 WP_001295493.1.87883 WP_001295493.1.87914 WP_001295493.1.87919 WP_001295493.1.87973 WP_001295493.1.87976 WP_001295493.1.87980 WP_001295493.1.87984 WP_001295493.1.87989 WP_001295493.1.87990 WP_001295493.1.880 WP_001295493.1.88017 WP_001295493.1.88020 WP_001295493.1.88066 WP_001295493.1.88082 WP_001295493.1.88088 WP_001295493.1.88110 WP_001295493.1.88119 WP_001295493.1.88147 WP_001295493.1.88149 WP_001295493.1.88155 WP_001295493.1.88189 WP_001295493.1.88197 WP_001295493.1.8822 WP_001295493.1.88238 WP_001295493.1.88252 WP_001295493.1.88263 WP_001295493.1.88285 WP_001295493.1.88301 WP_001295493.1.88304 WP_001295493.1.88336 WP_001295493.1.88352 WP_001295493.1.88376 WP_001295493.1.88379 WP_001295493.1.88384 WP_001295493.1.88413 WP_001295493.1.88427 WP_001295493.1.8843 WP_001295493.1.88434 WP_001295493.1.88438 WP_001295493.1.88462 WP_001295493.1.88467 WP_001295493.1.88499 WP_001295493.1.88505 WP_001295493.1.88524 WP_001295493.1.88527 WP_001295493.1.88528 WP_001295493.1.88535 WP_001295493.1.88539 WP_001295493.1.8854 WP_001295493.1.8855 WP_001295493.1.88557 WP_001295493.1.88577 WP_001295493.1.88598 WP_001295493.1.88603 WP_001295493.1.88607 WP_001295493.1.88631 WP_001295493.1.88646 WP_001295493.1.88667 WP_001295493.1.88678 WP_001295493.1.88685 WP_001295493.1.88686 WP_001295493.1.88709 WP_001295493.1.88710 WP_001295493.1.88711 WP_001295493.1.88720 WP_001295493.1.88729 WP_001295493.1.88732 WP_001295493.1.88735 WP_001295493.1.88752 WP_001295493.1.88757 WP_001295493.1.88759 WP_001295493.1.88767 WP_001295493.1.8879 WP_001295493.1.88793 WP_001295493.1.88803 WP_001295493.1.88826 WP_001295493.1.88834 WP_001295493.1.88864 WP_001295493.1.88883 WP_001295493.1.88891 WP_001295493.1.88941 WP_001295493.1.88950 WP_001295493.1.88953 WP_001295493.1.88961 WP_001295493.1.88997 WP_001295493.1.89018 WP_001295493.1.89043 WP_001295493.1.89050 WP_001295493.1.8906 WP_001295493.1.89067 WP_001295493.1.89090 WP_001295493.1.89097 WP_001295493.1.89099 WP_001295493.1.89111 WP_001295493.1.89150 WP_001295493.1.89163 WP_001295493.1.89165 WP_001295493.1.89183 WP_001295493.1.89197 WP_001295493.1.89200 WP_001295493.1.89203 WP_001295493.1.89214 WP_001295493.1.89217 WP_001295493.1.89255 WP_001295493.1.8928 WP_001295493.1.89285 WP_001295493.1.89305 WP_001295493.1.89322 WP_001295493.1.89379 WP_001295493.1.8938 WP_001295493.1.89385 WP_001295493.1.89396 WP_001295493.1.894 WP_001295493.1.89400 WP_001295493.1.89403 WP_001295493.1.89405 WP_001295493.1.89416 WP_001295493.1.89432 WP_001295493.1.8945 WP_001295493.1.89458 WP_001295493.1.89466 WP_001295493.1.89468 WP_001295493.1.89469 WP_001295493.1.89471 WP_001295493.1.89474 WP_001295493.1.89479 WP_001295493.1.89492 WP_001295493.1.89510 WP_001295493.1.89551 WP_001295493.1.89569 WP_001295493.1.89583 WP_001295493.1.89601 WP_001295493.1.89605 WP_001295493.1.89630 WP_001295493.1.89646 WP_001295493.1.89656 WP_001295493.1.89674 WP_001295493.1.89679 WP_001295493.1.89700 WP_001295493.1.89710 WP_001295493.1.89768 WP_001295493.1.89781 WP_001295493.1.89788 WP_001295493.1.89818 WP_001295493.1.89839 WP_001295493.1.89841 WP_001295493.1.8985 WP_001295493.1.89852 WP_001295493.1.89859 WP_001295493.1.89879 WP_001295493.1.89895 WP_001295493.1.89899 WP_001295493.1.89915 WP_001295493.1.89917 WP_001295493.1.89918 WP_001295493.1.89920 WP_001295493.1.89923 WP_001295493.1.89925 WP_001295493.1.89927 WP_001295493.1.89959 WP_001295493.1.89988 WP_001295493.1.89998 WP_001295493.1.90017 WP_001295493.1.90050 WP_001295493.1.90063 WP_001295493.1.90065 WP_001295493.1.90078 WP_001295493.1.9009 WP_001295493.1.9010 WP_001295493.1.90115 WP_001295493.1.90128 WP_001295493.1.90139 WP_001295493.1.90146 WP_001295493.1.90156 WP_001295493.1.90168 WP_001295493.1.90182 WP_001295493.1.902 WP_001295493.1.90205 WP_001295493.1.90219 WP_001295493.1.90249 WP_001295493.1.90256 WP_001295493.1.90257 WP_001295493.1.90266 WP_001295493.1.90270 WP_001295493.1.90314 WP_001295493.1.90332 WP_001295493.1.90342 WP_001295493.1.90346 WP_001295493.1.90349 WP_001295493.1.90357 WP_001295493.1.90358 WP_001295493.1.9036 WP_001295493.1.9037 WP_001295493.1.90389 WP_001295493.1.90405 WP_001295493.1.90435 WP_001295493.1.90436 WP_001295493.1.90441 WP_001295493.1.90449 WP_001295493.1.90467 WP_001295493.1.90511 WP_001295493.1.90520 WP_001295493.1.90536 WP_001295493.1.90547 WP_001295493.1.9059 WP_001295493.1.90591 WP_001295493.1.9061 WP_001295493.1.90626 WP_001295493.1.90690 WP_001295493.1.90703 WP_001295493.1.90706 WP_001295493.1.90758 WP_001295493.1.90775 WP_001295493.1.90799 WP_001295493.1.9081 WP_001295493.1.90813 WP_001295493.1.90822 WP_001295493.1.90828 WP_001295493.1.90834 WP_001295493.1.90837 WP_001295493.1.90839 WP_001295493.1.9084 WP_001295493.1.90842 WP_001295493.1.90844 WP_001295493.1.90848 WP_001295493.1.90856 WP_001295493.1.90864 WP_001295493.1.90865 WP_001295493.1.9087 WP_001295493.1.90873 WP_001295493.1.90890 WP_001295493.1.909 WP_001295493.1.90905 WP_001295493.1.90924 WP_001295493.1.90951 WP_001295493.1.90960 WP_001295493.1.90967 WP_001295493.1.90979 WP_001295493.1.9098 WP_001295493.1.90988 WP_001295493.1.90996 WP_001295493.1.90997 WP_001295493.1.91 WP_001295493.1.91007 WP_001295493.1.9104 WP_001295493.1.91072 WP_001295493.1.91088 WP_001295493.1.91094 WP_001295493.1.91113 WP_001295493.1.91117 WP_001295493.1.91121 WP_001295493.1.91138 WP_001295493.1.91143 WP_001295493.1.91153 WP_001295493.1.91170 WP_001295493.1.9118 WP_001295493.1.91182 WP_001295493.1.91220 WP_001295493.1.91266 WP_001295493.1.91268 WP_001295493.1.91277 WP_001295493.1.91288 WP_001295493.1.91290 WP_001295493.1.91340 WP_001295493.1.91341 WP_001295493.1.91354 WP_001295493.1.91356 WP_001295493.1.91361 WP_001295493.1.91384 WP_001295493.1.91397 WP_001295493.1.91414 WP_001295493.1.91425 WP_001295493.1.91445 WP_001295493.1.91462 WP_001295493.1.91485 WP_001295493.1.915 WP_001295493.1.91511 WP_001295493.1.91515 WP_001295493.1.91516 WP_001295493.1.91526 WP_001295493.1.91543 WP_001295493.1.91548 WP_001295493.1.91549 WP_001295493.1.91551 WP_001295493.1.91565 WP_001295493.1.91566 WP_001295493.1.9157 WP_001295493.1.91594 WP_001295493.1.91596 WP_001295493.1.9160 WP_001295493.1.91626 WP_001295493.1.91630 WP_001295493.1.91640 WP_001295493.1.91643 WP_001295493.1.91644 WP_001295493.1.91651 WP_001295493.1.91666 WP_001295493.1.91672 WP_001295493.1.9168 WP_001295493.1.91685 WP_001295493.1.9169 WP_001295493.1.91701 WP_001295493.1.9171 WP_001295493.1.91739 WP_001295493.1.91756 WP_001295493.1.91777 WP_001295493.1.91779 WP_001295493.1.91782 WP_001295493.1.91787 WP_001295493.1.91793 WP_001295493.1.91801 WP_001295493.1.91850 WP_001295493.1.91863 WP_001295493.1.91871 WP_001295493.1.91951 WP_001295493.1.91954 WP_001295493.1.91959 WP_001295493.1.91965 WP_001295493.1.91971 WP_001295493.1.9199 WP_001295493.1.91994 WP_001295493.1.92005 WP_001295493.1.92014 WP_001295493.1.92019 WP_001295493.1.92025 WP_001295493.1.92029 WP_001295493.1.92031 WP_001295493.1.92048 WP_001295493.1.92058 WP_001295493.1.9209 WP_001295493.1.921 WP_001295493.1.92102 WP_001295493.1.92123 WP_001295493.1.9215 WP_001295493.1.92161 WP_001295493.1.92163 WP_001295493.1.92180 WP_001295493.1.92195 WP_001295493.1.92215 WP_001295493.1.92276 WP_001295493.1.92295 WP_001295493.1.92304 WP_001295493.1.92305 WP_001295493.1.92311 WP_001295493.1.92323 WP_001295493.1.92361 WP_001295493.1.92384 WP_001295493.1.924 WP_001295493.1.92434 WP_001295493.1.92462 WP_001295493.1.92495 WP_001295493.1.92496 WP_001295493.1.92506 WP_001295493.1.92532 WP_001295493.1.92535 WP_001295493.1.9255 WP_001295493.1.92568 WP_001295493.1.92571 WP_001295493.1.92577 WP_001295493.1.92614 WP_001295493.1.92615 WP_001295493.1.92634 WP_001295493.1.92638 WP_001295493.1.9264 WP_001295493.1.9266 WP_001295493.1.92668 WP_001295493.1.92693 WP_001295493.1.92719 WP_001295493.1.92742 WP_001295493.1.92767 WP_001295493.1.92780 WP_001295493.1.92781 WP_001295493.1.92792 WP_001295493.1.92793 WP_001295493.1.92796 WP_001295493.1.92819 WP_001295493.1.92845 WP_001295493.1.92865 WP_001295493.1.92882 WP_001295493.1.92886 WP_001295493.1.92932 WP_001295493.1.92943 WP_001295493.1.92953 WP_001295493.1.92989 WP_001295493.1.92991 WP_001295493.1.93005 WP_001295493.1.93016 WP_001295493.1.93017 WP_001295493.1.93019 WP_001295493.1.93023 WP_001295493.1.93027 WP_001295493.1.93033 WP_001295493.1.93048 WP_001295493.1.93052 WP_001295493.1.93054 WP_001295493.1.93069 WP_001295493.1.93072 WP_001295493.1.93085 WP_001295493.1.93100 WP_001295493.1.93112 WP_001295493.1.93138 WP_001295493.1.93139 WP_001295493.1.93150 WP_001295493.1.93167 WP_001295493.1.93175 WP_001295493.1.93185 WP_001295493.1.93233 WP_001295493.1.93252 WP_001295493.1.93267 WP_001295493.1.9327 WP_001295493.1.93276 WP_001295493.1.93309 WP_001295493.1.9331 WP_001295493.1.93312 WP_001295493.1.93326 WP_001295493.1.93338 WP_001295493.1.93379 WP_001295493.1.93388 WP_001295493.1.934 WP_001295493.1.93427 WP_001295493.1.93428 WP_001295493.1.93431 WP_001295493.1.93453 WP_001295493.1.93461 WP_001295493.1.93463 WP_001295493.1.93464 WP_001295493.1.93468 WP_001295493.1.93509 WP_001295493.1.93531 WP_001295493.1.93552 WP_001295493.1.9356 WP_001295493.1.93569 WP_001295493.1.93601 WP_001295493.1.93605 WP_001295493.1.93621 WP_001295493.1.93626 WP_001295493.1.93629 WP_001295493.1.93630 WP_001295493.1.93634 WP_001295493.1.93637 WP_001295493.1.93652 WP_001295493.1.93665 WP_001295493.1.93670 WP_001295493.1.93673 WP_001295493.1.93695 WP_001295493.1.93716 WP_001295493.1.93733 WP_001295493.1.93737 WP_001295493.1.93742 WP_001295493.1.93743 WP_001295493.1.93745 WP_001295493.1.93755 WP_001295493.1.93765 WP_001295493.1.938 WP_001295493.1.93800 WP_001295493.1.93821 WP_001295493.1.93870 WP_001295493.1.93873 WP_001295493.1.93877 WP_001295493.1.939 WP_001295493.1.93900 WP_001295493.1.93911 WP_001295493.1.93918 WP_001295493.1.93921 WP_001295493.1.93922 WP_001295493.1.93939 WP_001295493.1.93951 WP_001295493.1.93952 WP_001295493.1.93971 WP_001295493.1.94008 WP_001295493.1.94011 WP_001295493.1.94025 WP_001295493.1.94028 WP_001295493.1.94035 WP_001295493.1.94040 WP_001295493.1.94057 WP_001295493.1.94156 WP_001295493.1.9416 WP_001295493.1.94176 WP_001295493.1.94190 WP_001295493.1.94213 WP_001295493.1.94232 WP_001295493.1.9426 WP_001295493.1.94271 WP_001295493.1.94298 WP_001295493.1.94302 WP_001295493.1.94317 WP_001295493.1.94343 WP_001295493.1.94353 WP_001295493.1.94367 WP_001295493.1.94388 WP_001295493.1.94404 WP_001295493.1.94417 WP_001295493.1.94429 WP_001295493.1.94430 WP_001295493.1.94436 WP_001295493.1.94445 WP_001295493.1.94468 WP_001295493.1.94475 WP_001295493.1.94497 WP_001295493.1.94507 WP_001295493.1.94516 WP_001295493.1.94523 WP_001295493.1.94542 WP_001295493.1.94544 WP_001295493.1.94548 WP_001295493.1.9457 WP_001295493.1.94578 WP_001295493.1.94580 WP_001295493.1.94589 WP_001295493.1.94619 WP_001295493.1.94626 WP_001295493.1.94646 WP_001295493.1.94653 WP_001295493.1.94676 WP_001295493.1.94686 WP_001295493.1.94690 WP_001295493.1.94692 WP_001295493.1.94695 WP_001295493.1.94738 WP_001295493.1.94739 WP_001295493.1.9474 WP_001295493.1.94753 WP_001295493.1.94764 WP_001295493.1.94787 WP_001295493.1.94790 WP_001295493.1.948 WP_001295493.1.94801 WP_001295493.1.94806 WP_001295493.1.94808 WP_001295493.1.94822 WP_001295493.1.94823 WP_001295493.1.94836 WP_001295493.1.94841 WP_001295493.1.94847 WP_001295493.1.94869 WP_001295493.1.94877 WP_001295493.1.94880 WP_001295493.1.94889 WP_001295493.1.9489 WP_001295493.1.94892 WP_001295493.1.94898 WP_001295493.1.949 WP_001295493.1.94903 WP_001295493.1.9491 WP_001295493.1.94927 WP_001295493.1.94934 WP_001295493.1.94935 WP_001295493.1.94938 WP_001295493.1.94949 WP_001295493.1.94955 WP_001295493.1.94963 WP_001295493.1.94991 WP_001295493.1.94993 WP_001295493.1.94997 WP_001295493.1.95005 WP_001295493.1.95011 WP_001295493.1.95022 WP_001295493.1.95028 WP_001295493.1.95035 WP_001295493.1.95036 WP_001295493.1.95037 WP_001295493.1.95062 WP_001295493.1.95084 WP_001295493.1.95105 WP_001295493.1.95129 WP_001295493.1.9513 WP_001295493.1.95161 WP_001295493.1.95198 WP_001295493.1.95233 WP_001295493.1.95243 WP_001295493.1.95244 WP_001295493.1.95254 WP_001295493.1.95275 WP_001295493.1.95329 WP_001295493.1.95332 WP_001295493.1.95366 WP_001295493.1.95368 WP_001295493.1.95378 WP_001295493.1.95381 WP_001295493.1.95390 WP_001295493.1.95395 WP_001295493.1.95398 WP_001295493.1.95400 WP_001295493.1.95403 WP_001295493.1.95424 WP_001295493.1.95428 WP_001295493.1.95431 WP_001295493.1.95438 WP_001295493.1.95449 WP_001295493.1.95490 WP_001295493.1.95518 WP_001295493.1.95521 WP_001295493.1.95563 WP_001295493.1.9559 WP_001295493.1.95595 WP_001295493.1.95596 WP_001295493.1.95604 WP_001295493.1.95611 WP_001295493.1.95628 WP_001295493.1.95634 WP_001295493.1.95655 WP_001295493.1.9566 WP_001295493.1.95666 WP_001295493.1.95712 WP_001295493.1.95756 WP_001295493.1.95759 WP_001295493.1.95771 WP_001295493.1.95783 WP_001295493.1.95784 WP_001295493.1.95800 WP_001295493.1.95821 WP_001295493.1.95824 WP_001295493.1.95827 WP_001295493.1.95834 WP_001295493.1.95835 WP_001295493.1.95849 WP_001295493.1.95861 WP_001295493.1.95865 WP_001295493.1.95869 WP_001295493.1.95916 WP_001295493.1.95919 WP_001295493.1.95929 WP_001295493.1.95931 WP_001295493.1.95932 WP_001295493.1.95951 WP_001295493.1.960 WP_001295493.1.96015 WP_001295493.1.96032 WP_001295493.1.96053 WP_001295493.1.96059 WP_001295493.1.96066 WP_001295493.1.96086 WP_001295493.1.96110 WP_001295493.1.96114 WP_001295493.1.96128 WP_001295493.1.96145 WP_001295493.1.9616 WP_001295493.1.96177 WP_001295493.1.96215 WP_001295493.1.96222 WP_001295493.1.96223 WP_001295493.1.96229 WP_001295493.1.96247 WP_001295493.1.96263 WP_001295493.1.96278 WP_001295493.1.96279 WP_001295493.1.96281 WP_001295493.1.96290 WP_001295493.1.96293 WP_001295493.1.96299 WP_001295493.1.96303 WP_001295493.1.9631 WP_001295493.1.96339 WP_001295493.1.96341 WP_001295493.1.96378 WP_001295493.1.96392 WP_001295493.1.96394 WP_001295493.1.9641 WP_001295493.1.96417 WP_001295493.1.96420 WP_001295493.1.96425 WP_001295493.1.96450 WP_001295493.1.96457 WP_001295493.1.96479 WP_001295493.1.96480 WP_001295493.1.96484 WP_001295493.1.9649 WP_001295493.1.96494 WP_001295493.1.965 WP_001295493.1.96519 WP_001295493.1.96541 WP_001295493.1.96558 WP_001295493.1.96562 WP_001295493.1.9657 WP_001295493.1.96585 WP_001295493.1.96608 WP_001295493.1.9661 WP_001295493.1.96650 WP_001295493.1.96659 WP_001295493.1.9668 WP_001295493.1.96680 WP_001295493.1.96683 WP_001295493.1.96701 WP_001295493.1.9671 WP_001295493.1.96725 WP_001295493.1.96743 WP_001295493.1.96753 WP_001295493.1.96762 WP_001295493.1.96769 WP_001295493.1.96779 WP_001295493.1.96796 WP_001295493.1.96817 WP_001295493.1.9682 WP_001295493.1.96820 WP_001295493.1.96850 WP_001295493.1.96864 WP_001295493.1.96894 WP_001295493.1.9690 WP_001295493.1.9691 WP_001295493.1.96924 WP_001295493.1.96932 WP_001295493.1.96936 WP_001295493.1.96944 WP_001295493.1.96971 WP_001295493.1.96984 WP_001295493.1.96989 WP_001295493.1.97011 WP_001295493.1.97027 WP_001295493.1.97049 WP_001295493.1.97059 WP_001295493.1.9708 WP_001295493.1.97119 WP_001295493.1.97123 WP_001295493.1.97147 WP_001295493.1.97193 WP_001295493.1.97195 WP_001295493.1.97200 WP_001295493.1.97226 WP_001295493.1.9723 WP_001295493.1.97231 WP_001295493.1.97238 WP_001295493.1.97248 WP_001295493.1.97269 WP_001295493.1.97279 WP_001295493.1.9729 WP_001295493.1.97292 WP_001295493.1.97344 WP_001295493.1.97351 WP_001295493.1.97356 WP_001295493.1.97360 WP_001295493.1.97361 WP_001295493.1.97379 WP_001295493.1.9740 WP_001295493.1.97402 WP_001295493.1.97418 WP_001295493.1.97421 WP_001295493.1.97434 WP_001295493.1.97437 WP_001295493.1.97439 WP_001295493.1.97459 WP_001295493.1.97464 WP_001295493.1.9747 WP_001295493.1.97490 WP_001295493.1.97502 WP_001295493.1.97513 WP_001295493.1.97527 WP_001295493.1.97538 WP_001295493.1.97544 WP_001295493.1.97560 WP_001295493.1.97571 WP_001295493.1.97619 WP_001295493.1.97632 WP_001295493.1.97667 WP_001295493.1.97675 WP_001295493.1.97677 WP_001295493.1.97685 WP_001295493.1.9770 WP_001295493.1.97705 WP_001295493.1.97711 WP_001295493.1.97770 WP_001295493.1.97775 WP_001295493.1.97789 WP_001295493.1.978 WP_001295493.1.97802 WP_001295493.1.97815 WP_001295493.1.97822 WP_001295493.1.97823 WP_001295493.1.97825 WP_001295493.1.97871 WP_001295493.1.97890 WP_001295493.1.97895 WP_001295493.1.97919 WP_001295493.1.97930 WP_001295493.1.97932 WP_001295493.1.97937 WP_001295493.1.97962 WP_001295493.1.97982 WP_001295493.1.97996 WP_001295493.1.98000 WP_001295493.1.98026 WP_001295493.1.9803 WP_001295493.1.98046 WP_001295493.1.98082 WP_001295493.1.98083 WP_001295493.1.981 WP_001295493.1.98115 WP_001295493.1.98139 WP_001295493.1.98155 WP_001295493.1.9816 WP_001295493.1.98167 WP_001295493.1.9817 WP_001295493.1.98176 WP_001295493.1.98187 WP_001295493.1.98202 WP_001295493.1.98205 WP_001295493.1.98208 WP_001295493.1.98220 WP_001295493.1.98232 WP_001295493.1.98235 WP_001295493.1.98239 WP_001295493.1.98241 WP_001295493.1.98244 WP_001295493.1.98279 WP_001295493.1.98284 WP_001295493.1.98292 WP_001295493.1.98294 WP_001295493.1.98301 WP_001295493.1.98312 WP_001295493.1.98323 WP_001295493.1.98355 WP_001295493.1.98357 WP_001295493.1.98384 WP_001295493.1.98400 WP_001295493.1.98404 WP_001295493.1.98424 WP_001295493.1.98429 WP_001295493.1.9844 WP_001295493.1.98442 WP_001295493.1.98451 WP_001295493.1.98466 WP_001295493.1.98477 WP_001295493.1.98480 WP_001295493.1.98484 WP_001295493.1.98498 WP_001295493.1.98543 WP_001295493.1.98549 WP_001295493.1.98569 WP_001295493.1.98578 WP_001295493.1.9858 WP_001295493.1.98587 WP_001295493.1.98603 WP_001295493.1.98614 WP_001295493.1.98628 WP_001295493.1.98633 WP_001295493.1.9864 WP_001295493.1.98641 WP_001295493.1.98654 WP_001295493.1.98665 WP_001295493.1.98668 WP_001295493.1.98683 WP_001295493.1.98702 WP_001295493.1.98776 WP_001295493.1.98784 WP_001295493.1.98795 WP_001295493.1.9883 WP_001295493.1.98875 WP_001295493.1.98886 WP_001295493.1.98908 WP_001295493.1.98920 WP_001295493.1.98976 WP_001295493.1.98988 WP_001295493.1.99029 WP_001295493.1.99046 WP_001295493.1.99053 WP_001295493.1.99060 WP_001295493.1.9907 WP_001295493.1.99101 WP_001295493.1.99110 WP_001295493.1.99119 WP_001295493.1.99168 WP_001295493.1.99182 WP_001295493.1.99209 WP_001295493.1.99234 WP_001295493.1.99246 WP_001295493.1.99265 WP_001295493.1.99289 WP_001295493.1.99292 WP_001295493.1.99295 WP_001295493.1.9930 WP_001295493.1.99302 WP_001295493.1.99304 WP_001295493.1.99306 WP_001295493.1.99307 WP_001295493.1.99310 WP_001295493.1.99319 WP_001295493.1.99334 WP_001295493.1.99345 WP_001295493.1.99349 WP_001295493.1.99361 WP_001295493.1.99366 WP_001295493.1.99392 WP_001295493.1.9940 WP_001295493.1.99400 WP_001295493.1.99427 WP_001295493.1.99446 WP_001295493.1.99453 WP_001295493.1.99458 WP_001295493.1.99471 WP_001295493.1.99475 WP_001295493.1.99486 WP_001295493.1.99487 WP_001295493.1.99498 WP_001295493.1.99501 WP_001295493.1.99511 WP_001295493.1.99534 WP_001295493.1.99562 WP_001295493.1.99571 WP_001295493.1.99592 WP_001295493.1.99602 WP_001295493.1.99603 WP_001295493.1.99619 WP_001295493.1.99632 WP_001295493.1.99641 WP_001295493.1.99666 WP_001295493.1.99692 WP_001295493.1.99694 WP_001295493.1.99698 WP_001295493.1.99771 WP_001295493.1.99774 WP_001295493.1.99782 WP_001295493.1.99791 WP_001295493.1.99804 WP_001295493.1.99827 WP_001295493.1.99869 WP_001295493.1.99891 WP_001295493.1.99892 WP_001295493.1.99912 WP_001295493.1.99929 WP_001295493.1.99986 YP_002407252.1.10275 YP_002412826.1.14968 YP_006778876.1.12065 gi|209400032|ref|YP_002270886.1| gi|387829718|ref|YP_003349655.1| gi|378712752|ref|YP_005277645.1| gi|209919174|ref|YP_002293258.1| gi|157161273|ref|YP_001458591.1| gi|388477882|ref|YP_490070.1| gi|387612295|ref|YP_006115411.1| gi|218705307|ref|YP_002412826.1| gi|386619377|ref|YP_006138957.1| gi|251785257|ref|YP_002999561.1| gi|157155431|ref|YP_001463110.1| gi|170680959|ref|YP_001743437.1| gi|238901023|ref|YP_002926819.1| gi|383178017|ref|YP_005456022.1| gi|187734023|ref|YP_001880601.1| gi|170081465|ref|YP_001730785.1| gi|544390452|ref|YP_008564986.1| gi|218699623|ref|YP_002407252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]