SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386621886|ref|YP_006141466.1| from Escherichia coli NA114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386621886|ref|YP_006141466.1|
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily YjgF-like 2.58e-70
Family YjgF/L-PSP 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386621886|ref|YP_006141466.1|
Sequence length 129
Comment hypothetical protein ECNA114_4346 [Escherichia coli NA114]
Sequence
MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAI
VVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLE
IEAIAVRSA
Download sequence
Identical sequences A0A023Z374 A0A024KMI8 A0A025CGC3 A0A026VB15 A0A027U081 A0A028A9X6 A0A028ECQ7 A0A029HIX8 A0A029ILL9 A0A062Y0F5 A0A064TA32 A0A070SVF0 A0A070UXB1 A0A073FSI4 A0A073H646 A0A073UP95 A0A074HSK6 A0A080FLA3 A0A080II70 A0A0A0FGA4 A0A0A8UJS9 A0A0E0U3G6 A0A0E0VAD7 A0A0E0XVE1 A0A0E1M1W4 A0A0E1T3U1 A0A0E2LGT3 A0A0E2UA97 A0A0F6C984 A0A0F6FCH5 A0A0G3K926 A0A0H3ENZ9 A0A0H3MKT2 A0A0H3PVT3 A0A0I1EZS3 A0A0M7N3Y8 A0A125WZ05 A0A127GPU8 A0A140N5K6 A0A142H6Y9 A0A181WVD6 A0A1E2VQL9 A0A1S9JW37 A0A1W2M7W5 A0A1X3LE73 A0A1X3LSY3 A0A1Z3UZA7 A0A222QRA1 A0A226KE54 A0A236M2H8 A0A2D0NV56 A0A2H1BAV6 B1LFL5 B2U0A3 B6I488 B7LH50 B7MB43 B7N0Q9 B7UJ17 C8TXA9 C8UG73 D3GWT0 D6I199 D6IE31 D6JEZ2 D7XRN7 D7XZ39 D7ZEF9 D8A8Q1 D8E507 E0IWM1 E1IL61 E1J0L4 E2QEF5 E3PK25 E6BFG1 E7SLT7 E7T5X4 E7T7K6 E9TH10 E9XGG3 E9YUL9 F3WNF2 F5NZP4 G0F715 H4JD83 H4UPG5 I0VVL3 I2RFJ9 I2RZ50 I2SWD7 I2UGX3 I2WZS5 I2X690 I4T2X5 I6BER6 I6DSS3 I6FLR6 I6GMU9 K0X7H6 K4VWA9 K4XPU4 L2VGS8 L2X9P3 L3C333 L3NWU8 L3PZX0 L3QBP0 L4J0Q5 L4V2Y5 M9GAL0 P0AGL2 P0AGL3 P0AGL4 S0VQP3 S0X9T4 S0YYN3 S1CYT5 S1EZN3 S1GJM4 S1HUR5 S1IPK7 S1PLY4 T5UAK1 T6A3X5 T6GX76 T6LFD7 T9A6D4 T9CBZ9 T9SG32 U9XS94 U9XT53 U9Y0M5 U9ZMD2 V0A0K7 V0SYL9 V0V4F3 V0XSQ2 V0YY23 V2RS86 V2STH4 V6FY14 V8FIE5 V8JX69 W1B7Y0 W1WXQ1
gi|157162595|ref|YP_001459913.1| gi|387884298|ref|YP_006314600.1| gi|387618418|ref|YP_006121440.1| gi|90111542|ref|NP_417583.4| gi|254163057|ref|YP_003046165.1| gi|544577672|ref|YP_008573196.1| gi|170082653|ref|YP_001731973.1| gi|410480816|ref|YP_006768362.1| gi|387831006|ref|YP_003350943.1| gi|260857241|ref|YP_003231132.1| gi|253772050|ref|YP_003034881.1| 2uyj_A 2uyj_B 2uyj_C 2uyk_A 2uyk_B 2uyk_C 2uyn_A 2uyn_B 2uyn_C 2uyp_A 2uyp_B 2uyp_C gi|187732750|ref|YP_001881608.1| gi|386615900|ref|YP_006135566.1| gi|407471087|ref|YP_006782470.1| gi|407480256|ref|YP_006777405.1| gi|110643359|ref|YP_671089.1| gi|215488440|ref|YP_002330871.1| gi|218701888|ref|YP_002409517.1| gi|386621886|ref|YP_006141466.1| gi|218560194|ref|YP_002393107.1| gi|386625924|ref|YP_006145652.1| gi|218691412|ref|YP_002399624.1| gi|260869866|ref|YP_003236268.1| gi|386602794|ref|YP_006109094.1| gi|383180299|ref|YP_005458304.1| gi|56480265|ref|NP_708917.2| gi|387508516|ref|YP_006160772.1| gi|387622779|ref|YP_006130407.1| gi|209397070|ref|YP_002272584.1| gi|209920588|ref|YP_002294672.1| gi|387622779|ref|YP_006130407.1| 198214.SF3153 198215.S3365 316385.ECDH10B_3287 316407.tdcF 331112.EcHS_A3301 344609.SbBS512_E3244 362663.ECP_3206 386585.ECs3993 409438.ECSE_3397 413997.ECB_02980 439855.EcSMS35_3409 444450.ECH74115_4426 469008.ECBD_0627 481805.EcolC_0585 511145.b3113 544404.ECSP_4085 573235.ECO26_4218 574521.E2348C_3403 585034.ECIAI1_3262 585035.ECS88_3506 585055.EC55989_3530 585057.ECIAI39_3614 585395.ECO103_3860 585396.ECO111_3937 585397.ECED1_3778 595496.BWG_2821 gi|443619185|ref|YP_007383041.1| gi|387608840|ref|YP_006097696.1| gi|388479110|ref|YP_491302.1| gi|38704141|ref|NP_312020.2| gi|378711430|ref|YP_005276323.1| TDCF_ECOLI gi|218555684|ref|YP_002388597.1| gi|544391602|ref|YP_008566279.1| gi|251786387|ref|YP_003000691.1| gi|386711018|ref|YP_006174739.1| gi|556553029|ref|YP_008723495.1| gi|238902221|ref|YP_002928017.1| NP_312020.2.58667 NP_417583.4.90541 NP_708917.2.23235 WP_000719990.1.1000 WP_000719990.1.10001 WP_000719990.1.100014 WP_000719990.1.100044 WP_000719990.1.100052 WP_000719990.1.100066 WP_000719990.1.100073 WP_000719990.1.100085 WP_000719990.1.10010 WP_000719990.1.100111 WP_000719990.1.100138 WP_000719990.1.100151 WP_000719990.1.100159 WP_000719990.1.100185 WP_000719990.1.100220 WP_000719990.1.100227 WP_000719990.1.100251 WP_000719990.1.100252 WP_000719990.1.100281 WP_000719990.1.100283 WP_000719990.1.100285 WP_000719990.1.100299 WP_000719990.1.100302 WP_000719990.1.100304 WP_000719990.1.100306 WP_000719990.1.10034 WP_000719990.1.100346 WP_000719990.1.100425 WP_000719990.1.100441 WP_000719990.1.100444 WP_000719990.1.100447 WP_000719990.1.100451 WP_000719990.1.100474 WP_000719990.1.100487 WP_000719990.1.100496 WP_000719990.1.100499 WP_000719990.1.100508 WP_000719990.1.10051 WP_000719990.1.100531 WP_000719990.1.100543 WP_000719990.1.100554 WP_000719990.1.100571 WP_000719990.1.100573 WP_000719990.1.100614 WP_000719990.1.100667 WP_000719990.1.10067 WP_000719990.1.10068 WP_000719990.1.100685 WP_000719990.1.100688 WP_000719990.1.100689 WP_000719990.1.100718 WP_000719990.1.100735 WP_000719990.1.100738 WP_000719990.1.100758 WP_000719990.1.100778 WP_000719990.1.100796 WP_000719990.1.10080 WP_000719990.1.100803 WP_000719990.1.100824 WP_000719990.1.100836 WP_000719990.1.100851 WP_000719990.1.10086 WP_000719990.1.100867 WP_000719990.1.100868 WP_000719990.1.100898 WP_000719990.1.100916 WP_000719990.1.100925 WP_000719990.1.100928 WP_000719990.1.100933 WP_000719990.1.10094 WP_000719990.1.100959 WP_000719990.1.100990 WP_000719990.1.101033 WP_000719990.1.101052 WP_000719990.1.101087 WP_000719990.1.101096 WP_000719990.1.101102 WP_000719990.1.101105 WP_000719990.1.101110 WP_000719990.1.101148 WP_000719990.1.101152 WP_000719990.1.101157 WP_000719990.1.101158 WP_000719990.1.101166 WP_000719990.1.101186 WP_000719990.1.101206 WP_000719990.1.101214 WP_000719990.1.101216 WP_000719990.1.101255 WP_000719990.1.101257 WP_000719990.1.10126 WP_000719990.1.101282 WP_000719990.1.101293 WP_000719990.1.10131 WP_000719990.1.101313 WP_000719990.1.101359 WP_000719990.1.10138 WP_000719990.1.101387 WP_000719990.1.101399 WP_000719990.1.101418 WP_000719990.1.101423 WP_000719990.1.101429 WP_000719990.1.101430 WP_000719990.1.101436 WP_000719990.1.101439 WP_000719990.1.101445 WP_000719990.1.101468 WP_000719990.1.101518 WP_000719990.1.101522 WP_000719990.1.101545 WP_000719990.1.101583 WP_000719990.1.101586 WP_000719990.1.101628 WP_000719990.1.101630 WP_000719990.1.101651 WP_000719990.1.101653 WP_000719990.1.101654 WP_000719990.1.101667 WP_000719990.1.101668 WP_000719990.1.101686 WP_000719990.1.101693 WP_000719990.1.101694 WP_000719990.1.101700 WP_000719990.1.101727 WP_000719990.1.10173 WP_000719990.1.101737 WP_000719990.1.101747 WP_000719990.1.101769 WP_000719990.1.101777 WP_000719990.1.101786 WP_000719990.1.10181 WP_000719990.1.101822 WP_000719990.1.10184 WP_000719990.1.101840 WP_000719990.1.101845 WP_000719990.1.101855 WP_000719990.1.101865 WP_000719990.1.10187 WP_000719990.1.10188 WP_000719990.1.10190 WP_000719990.1.101900 WP_000719990.1.101913 WP_000719990.1.101926 WP_000719990.1.101932 WP_000719990.1.101947 WP_000719990.1.101948 WP_000719990.1.101952 WP_000719990.1.101962 WP_000719990.1.101964 WP_000719990.1.101969 WP_000719990.1.101977 WP_000719990.1.101984 WP_000719990.1.101987 WP_000719990.1.102021 WP_000719990.1.102036 WP_000719990.1.10206 WP_000719990.1.102069 WP_000719990.1.102076 WP_000719990.1.102104 WP_000719990.1.102106 WP_000719990.1.102122 WP_000719990.1.102139 WP_000719990.1.102144 WP_000719990.1.10222 WP_000719990.1.10226 WP_000719990.1.10233 WP_000719990.1.10235 WP_000719990.1.10273 WP_000719990.1.10304 WP_000719990.1.10326 WP_000719990.1.10335 WP_000719990.1.10361 WP_000719990.1.10379 WP_000719990.1.10381 WP_000719990.1.1040 WP_000719990.1.10400 WP_000719990.1.10417 WP_000719990.1.10461 WP_000719990.1.10476 WP_000719990.1.10491 WP_000719990.1.10492 WP_000719990.1.10496 WP_000719990.1.10524 WP_000719990.1.10538 WP_000719990.1.10569 WP_000719990.1.10573 WP_000719990.1.10579 WP_000719990.1.1058 WP_000719990.1.10605 WP_000719990.1.10607 WP_000719990.1.10673 WP_000719990.1.10697 WP_000719990.1.10705 WP_000719990.1.1071 WP_000719990.1.10715 WP_000719990.1.1073 WP_000719990.1.1074 WP_000719990.1.10744 WP_000719990.1.10748 WP_000719990.1.10761 WP_000719990.1.10763 WP_000719990.1.10786 WP_000719990.1.10798 WP_000719990.1.10809 WP_000719990.1.10814 WP_000719990.1.10824 WP_000719990.1.10833 WP_000719990.1.10842 WP_000719990.1.10849 WP_000719990.1.10869 WP_000719990.1.10922 WP_000719990.1.10970 WP_000719990.1.10988 WP_000719990.1.10989 WP_000719990.1.10994 WP_000719990.1.11006 WP_000719990.1.11032 WP_000719990.1.11047 WP_000719990.1.11052 WP_000719990.1.11057 WP_000719990.1.11068 WP_000719990.1.11071 WP_000719990.1.11091 WP_000719990.1.1111 WP_000719990.1.11113 WP_000719990.1.11118 WP_000719990.1.11121 WP_000719990.1.1113 WP_000719990.1.11133 WP_000719990.1.112 WP_000719990.1.11217 WP_000719990.1.1122 WP_000719990.1.11240 WP_000719990.1.11241 WP_000719990.1.11250 WP_000719990.1.11265 WP_000719990.1.11285 WP_000719990.1.11296 WP_000719990.1.11301 WP_000719990.1.11315 WP_000719990.1.11399 WP_000719990.1.11408 WP_000719990.1.11411 WP_000719990.1.11418 WP_000719990.1.11420 WP_000719990.1.11436 WP_000719990.1.11437 WP_000719990.1.11467 WP_000719990.1.11519 WP_000719990.1.11524 WP_000719990.1.11531 WP_000719990.1.11542 WP_000719990.1.11575 WP_000719990.1.11578 WP_000719990.1.11607 WP_000719990.1.11608 WP_000719990.1.11612 WP_000719990.1.11616 WP_000719990.1.11645 WP_000719990.1.11671 WP_000719990.1.11673 WP_000719990.1.1168 WP_000719990.1.11690 WP_000719990.1.11699 WP_000719990.1.11748 WP_000719990.1.11759 WP_000719990.1.1176 WP_000719990.1.11762 WP_000719990.1.11801 WP_000719990.1.11803 WP_000719990.1.11844 WP_000719990.1.1186 WP_000719990.1.11912 WP_000719990.1.11949 WP_000719990.1.11955 WP_000719990.1.11956 WP_000719990.1.1196 WP_000719990.1.11981 WP_000719990.1.11982 WP_000719990.1.11985 WP_000719990.1.12009 WP_000719990.1.12010 WP_000719990.1.12030 WP_000719990.1.12036 WP_000719990.1.12050 WP_000719990.1.12051 WP_000719990.1.12060 WP_000719990.1.12076 WP_000719990.1.12088 WP_000719990.1.12111 WP_000719990.1.12112 WP_000719990.1.12151 WP_000719990.1.12157 WP_000719990.1.12174 WP_000719990.1.1218 WP_000719990.1.12230 WP_000719990.1.12259 WP_000719990.1.12268 WP_000719990.1.12279 WP_000719990.1.12295 WP_000719990.1.12305 WP_000719990.1.12319 WP_000719990.1.12320 WP_000719990.1.12342 WP_000719990.1.12344 WP_000719990.1.12415 WP_000719990.1.1242 WP_000719990.1.12426 WP_000719990.1.12458 WP_000719990.1.12459 WP_000719990.1.12468 WP_000719990.1.12478 WP_000719990.1.12542 WP_000719990.1.12552 WP_000719990.1.12558 WP_000719990.1.12566 WP_000719990.1.12574 WP_000719990.1.12582 WP_000719990.1.12594 WP_000719990.1.12623 WP_000719990.1.12645 WP_000719990.1.12675 WP_000719990.1.12679 WP_000719990.1.12680 WP_000719990.1.12693 WP_000719990.1.12697 WP_000719990.1.127 WP_000719990.1.12709 WP_000719990.1.12717 WP_000719990.1.12743 WP_000719990.1.12749 WP_000719990.1.1275 WP_000719990.1.12756 WP_000719990.1.12761 WP_000719990.1.12762 WP_000719990.1.12763 WP_000719990.1.12766 WP_000719990.1.12775 WP_000719990.1.1278 WP_000719990.1.12781 WP_000719990.1.12826 WP_000719990.1.12830 WP_000719990.1.12831 WP_000719990.1.12876 WP_000719990.1.12893 WP_000719990.1.12911 WP_000719990.1.12914 WP_000719990.1.12915 WP_000719990.1.12917 WP_000719990.1.12944 WP_000719990.1.1295 WP_000719990.1.12956 WP_000719990.1.12965 WP_000719990.1.12976 WP_000719990.1.12979 WP_000719990.1.12987 WP_000719990.1.12991 WP_000719990.1.13002 WP_000719990.1.13015 WP_000719990.1.13031 WP_000719990.1.13060 WP_000719990.1.13074 WP_000719990.1.1308 WP_000719990.1.13117 WP_000719990.1.1312 WP_000719990.1.13136 WP_000719990.1.1314 WP_000719990.1.13144 WP_000719990.1.13157 WP_000719990.1.13162 WP_000719990.1.13181 WP_000719990.1.13205 WP_000719990.1.13217 WP_000719990.1.13223 WP_000719990.1.1323 WP_000719990.1.13239 WP_000719990.1.13252 WP_000719990.1.13258 WP_000719990.1.13271 WP_000719990.1.13272 WP_000719990.1.13278 WP_000719990.1.13290 WP_000719990.1.13295 WP_000719990.1.13332 WP_000719990.1.13333 WP_000719990.1.13348 WP_000719990.1.1335 WP_000719990.1.13393 WP_000719990.1.13409 WP_000719990.1.1343 WP_000719990.1.13430 WP_000719990.1.13437 WP_000719990.1.13442 WP_000719990.1.1345 WP_000719990.1.13451 WP_000719990.1.13469 WP_000719990.1.13473 WP_000719990.1.13481 WP_000719990.1.13492 WP_000719990.1.13495 WP_000719990.1.13525 WP_000719990.1.13585 WP_000719990.1.13601 WP_000719990.1.13608 WP_000719990.1.13618 WP_000719990.1.13626 WP_000719990.1.13644 WP_000719990.1.13656 WP_000719990.1.13662 WP_000719990.1.13664 WP_000719990.1.13778 WP_000719990.1.13791 WP_000719990.1.13798 WP_000719990.1.13824 WP_000719990.1.13867 WP_000719990.1.13877 WP_000719990.1.13881 WP_000719990.1.13891 WP_000719990.1.13924 WP_000719990.1.13934 WP_000719990.1.13936 WP_000719990.1.13939 WP_000719990.1.13944 WP_000719990.1.13949 WP_000719990.1.13974 WP_000719990.1.14023 WP_000719990.1.14030 WP_000719990.1.14058 WP_000719990.1.14062 WP_000719990.1.14070 WP_000719990.1.14110 WP_000719990.1.14129 WP_000719990.1.14144 WP_000719990.1.14164 WP_000719990.1.1419 WP_000719990.1.14199 WP_000719990.1.14245 WP_000719990.1.14253 WP_000719990.1.14277 WP_000719990.1.14292 WP_000719990.1.14322 WP_000719990.1.14331 WP_000719990.1.14371 WP_000719990.1.1438 WP_000719990.1.14389 WP_000719990.1.1439 WP_000719990.1.14398 WP_000719990.1.14417 WP_000719990.1.14432 WP_000719990.1.14445 WP_000719990.1.14453 WP_000719990.1.14468 WP_000719990.1.14493 WP_000719990.1.14501 WP_000719990.1.14506 WP_000719990.1.14508 WP_000719990.1.14509 WP_000719990.1.14538 WP_000719990.1.14581 WP_000719990.1.14582 WP_000719990.1.14600 WP_000719990.1.14601 WP_000719990.1.14605 WP_000719990.1.14607 WP_000719990.1.1461 WP_000719990.1.14616 WP_000719990.1.14621 WP_000719990.1.14661 WP_000719990.1.14672 WP_000719990.1.14678 WP_000719990.1.14687 WP_000719990.1.14693 WP_000719990.1.1470 WP_000719990.1.14711 WP_000719990.1.14712 WP_000719990.1.14748 WP_000719990.1.14749 WP_000719990.1.14807 WP_000719990.1.14811 WP_000719990.1.1486 WP_000719990.1.14871 WP_000719990.1.14914 WP_000719990.1.14934 WP_000719990.1.14935 WP_000719990.1.14946 WP_000719990.1.14956 WP_000719990.1.14958 WP_000719990.1.14963 WP_000719990.1.14977 WP_000719990.1.15020 WP_000719990.1.15041 WP_000719990.1.15068 WP_000719990.1.1508 WP_000719990.1.15087 WP_000719990.1.1510 WP_000719990.1.15117 WP_000719990.1.15121 WP_000719990.1.15138 WP_000719990.1.15177 WP_000719990.1.15193 WP_000719990.1.15221 WP_000719990.1.1524 WP_000719990.1.15245 WP_000719990.1.15252 WP_000719990.1.15270 WP_000719990.1.15274 WP_000719990.1.15277 WP_000719990.1.15282 WP_000719990.1.15287 WP_000719990.1.15290 WP_000719990.1.153 WP_000719990.1.15300 WP_000719990.1.15304 WP_000719990.1.15332 WP_000719990.1.15335 WP_000719990.1.15347 WP_000719990.1.15356 WP_000719990.1.15377 WP_000719990.1.15416 WP_000719990.1.15420 WP_000719990.1.1543 WP_000719990.1.15444 WP_000719990.1.15453 WP_000719990.1.15464 WP_000719990.1.15469 WP_000719990.1.15496 WP_000719990.1.1550 WP_000719990.1.15521 WP_000719990.1.15527 WP_000719990.1.15528 WP_000719990.1.15538 WP_000719990.1.15576 WP_000719990.1.15583 WP_000719990.1.1559 WP_000719990.1.15593 WP_000719990.1.15600 WP_000719990.1.1561 WP_000719990.1.15624 WP_000719990.1.15626 WP_000719990.1.15645 WP_000719990.1.15654 WP_000719990.1.15702 WP_000719990.1.15707 WP_000719990.1.15740 WP_000719990.1.15747 WP_000719990.1.15762 WP_000719990.1.15767 WP_000719990.1.15768 WP_000719990.1.15782 WP_000719990.1.15809 WP_000719990.1.1582 WP_000719990.1.15855 WP_000719990.1.15857 WP_000719990.1.15863 WP_000719990.1.1588 WP_000719990.1.15906 WP_000719990.1.15916 WP_000719990.1.15945 WP_000719990.1.15949 WP_000719990.1.15951 WP_000719990.1.15983 WP_000719990.1.15984 WP_000719990.1.15990 WP_000719990.1.16010 WP_000719990.1.16014 WP_000719990.1.16034 WP_000719990.1.1604 WP_000719990.1.16042 WP_000719990.1.16067 WP_000719990.1.16075 WP_000719990.1.16086 WP_000719990.1.16087 WP_000719990.1.16111 WP_000719990.1.16117 WP_000719990.1.16131 WP_000719990.1.16133 WP_000719990.1.16154 WP_000719990.1.16171 WP_000719990.1.16175 WP_000719990.1.16179 WP_000719990.1.16183 WP_000719990.1.16194 WP_000719990.1.1621 WP_000719990.1.1622 WP_000719990.1.16222 WP_000719990.1.16270 WP_000719990.1.16272 WP_000719990.1.16294 WP_000719990.1.163 WP_000719990.1.16322 WP_000719990.1.1634 WP_000719990.1.16387 WP_000719990.1.16388 WP_000719990.1.16396 WP_000719990.1.1640 WP_000719990.1.16435 WP_000719990.1.16463 WP_000719990.1.16481 WP_000719990.1.16482 WP_000719990.1.16500 WP_000719990.1.16517 WP_000719990.1.16532 WP_000719990.1.16539 WP_000719990.1.16541 WP_000719990.1.16577 WP_000719990.1.16592 WP_000719990.1.16608 WP_000719990.1.16612 WP_000719990.1.16648 WP_000719990.1.16667 WP_000719990.1.16682 WP_000719990.1.16700 WP_000719990.1.16705 WP_000719990.1.16715 WP_000719990.1.16721 WP_000719990.1.1673 WP_000719990.1.16745 WP_000719990.1.16752 WP_000719990.1.16766 WP_000719990.1.16780 WP_000719990.1.16798 WP_000719990.1.16799 WP_000719990.1.16805 WP_000719990.1.16807 WP_000719990.1.16818 WP_000719990.1.16843 WP_000719990.1.16845 WP_000719990.1.16862 WP_000719990.1.16927 WP_000719990.1.16979 WP_000719990.1.16992 WP_000719990.1.17014 WP_000719990.1.17018 WP_000719990.1.17061 WP_000719990.1.17084 WP_000719990.1.17087 WP_000719990.1.1710 WP_000719990.1.17101 WP_000719990.1.17102 WP_000719990.1.17109 WP_000719990.1.17111 WP_000719990.1.17114 WP_000719990.1.17119 WP_000719990.1.17123 WP_000719990.1.17150 WP_000719990.1.17153 WP_000719990.1.17170 WP_000719990.1.17172 WP_000719990.1.17182 WP_000719990.1.17187 WP_000719990.1.17206 WP_000719990.1.17216 WP_000719990.1.17241 WP_000719990.1.17242 WP_000719990.1.17267 WP_000719990.1.17282 WP_000719990.1.17290 WP_000719990.1.17297 WP_000719990.1.1731 WP_000719990.1.17325 WP_000719990.1.17333 WP_000719990.1.17356 WP_000719990.1.17360 WP_000719990.1.17373 WP_000719990.1.17386 WP_000719990.1.17387 WP_000719990.1.17389 WP_000719990.1.17392 WP_000719990.1.17403 WP_000719990.1.17410 WP_000719990.1.17415 WP_000719990.1.17417 WP_000719990.1.17432 WP_000719990.1.17461 WP_000719990.1.17464 WP_000719990.1.17496 WP_000719990.1.17515 WP_000719990.1.17534 WP_000719990.1.1754 WP_000719990.1.1755 WP_000719990.1.17550 WP_000719990.1.17577 WP_000719990.1.17584 WP_000719990.1.17595 WP_000719990.1.17623 WP_000719990.1.1763 WP_000719990.1.17637 WP_000719990.1.1766 WP_000719990.1.17680 WP_000719990.1.1769 WP_000719990.1.17701 WP_000719990.1.17711 WP_000719990.1.17734 WP_000719990.1.17757 WP_000719990.1.17766 WP_000719990.1.17769 WP_000719990.1.1778 WP_000719990.1.17802 WP_000719990.1.17829 WP_000719990.1.17831 WP_000719990.1.17849 WP_000719990.1.17904 WP_000719990.1.17920 WP_000719990.1.17925 WP_000719990.1.17937 WP_000719990.1.17952 WP_000719990.1.17961 WP_000719990.1.17963 WP_000719990.1.17984 WP_000719990.1.18000 WP_000719990.1.18006 WP_000719990.1.1802 WP_000719990.1.18024 WP_000719990.1.18050 WP_000719990.1.18064 WP_000719990.1.18094 WP_000719990.1.18112 WP_000719990.1.18118 WP_000719990.1.18121 WP_000719990.1.18133 WP_000719990.1.18134 WP_000719990.1.18136 WP_000719990.1.18164 WP_000719990.1.18175 WP_000719990.1.1821 WP_000719990.1.18225 WP_000719990.1.18229 WP_000719990.1.18275 WP_000719990.1.18316 WP_000719990.1.18326 WP_000719990.1.18329 WP_000719990.1.18337 WP_000719990.1.18338 WP_000719990.1.1834 WP_000719990.1.18340 WP_000719990.1.18348 WP_000719990.1.18381 WP_000719990.1.18383 WP_000719990.1.18394 WP_000719990.1.18402 WP_000719990.1.18410 WP_000719990.1.18420 WP_000719990.1.18436 WP_000719990.1.18438 WP_000719990.1.1844 WP_000719990.1.18458 WP_000719990.1.18461 WP_000719990.1.18472 WP_000719990.1.18482 WP_000719990.1.18519 WP_000719990.1.18530 WP_000719990.1.18550 WP_000719990.1.18556 WP_000719990.1.18581 WP_000719990.1.18588 WP_000719990.1.18617 WP_000719990.1.1862 WP_000719990.1.18649 WP_000719990.1.18650 WP_000719990.1.18655 WP_000719990.1.1866 WP_000719990.1.18666 WP_000719990.1.18675 WP_000719990.1.18699 WP_000719990.1.18714 WP_000719990.1.18725 WP_000719990.1.18726 WP_000719990.1.1873 WP_000719990.1.18734 WP_000719990.1.18794 WP_000719990.1.188 WP_000719990.1.18801 WP_000719990.1.18802 WP_000719990.1.1881 WP_000719990.1.18828 WP_000719990.1.18837 WP_000719990.1.18858 WP_000719990.1.18861 WP_000719990.1.18874 WP_000719990.1.18876 WP_000719990.1.18899 WP_000719990.1.18908 WP_000719990.1.18923 WP_000719990.1.18934 WP_000719990.1.18936 WP_000719990.1.1896 WP_000719990.1.18962 WP_000719990.1.18966 WP_000719990.1.18983 WP_000719990.1.18995 WP_000719990.1.19024 WP_000719990.1.1903 WP_000719990.1.19036 WP_000719990.1.19039 WP_000719990.1.1906 WP_000719990.1.19075 WP_000719990.1.1909 WP_000719990.1.19090 WP_000719990.1.191 WP_000719990.1.19100 WP_000719990.1.19114 WP_000719990.1.19129 WP_000719990.1.19135 WP_000719990.1.19140 WP_000719990.1.19146 WP_000719990.1.19147 WP_000719990.1.19148 WP_000719990.1.1915 WP_000719990.1.19150 WP_000719990.1.19153 WP_000719990.1.19171 WP_000719990.1.19194 WP_000719990.1.19205 WP_000719990.1.19206 WP_000719990.1.19245 WP_000719990.1.1925 WP_000719990.1.19277 WP_000719990.1.19297 WP_000719990.1.193 WP_000719990.1.19312 WP_000719990.1.19313 WP_000719990.1.19314 WP_000719990.1.19315 WP_000719990.1.19332 WP_000719990.1.19350 WP_000719990.1.19361 WP_000719990.1.19374 WP_000719990.1.19379 WP_000719990.1.19389 WP_000719990.1.19397 WP_000719990.1.19419 WP_000719990.1.19424 WP_000719990.1.19441 WP_000719990.1.19448 WP_000719990.1.19453 WP_000719990.1.19465 WP_000719990.1.19478 WP_000719990.1.19492 WP_000719990.1.19494 WP_000719990.1.19534 WP_000719990.1.19544 WP_000719990.1.19547 WP_000719990.1.19557 WP_000719990.1.19581 WP_000719990.1.19583 WP_000719990.1.19593 WP_000719990.1.1960 WP_000719990.1.19602 WP_000719990.1.1963 WP_000719990.1.19644 WP_000719990.1.19649 WP_000719990.1.19651 WP_000719990.1.19654 WP_000719990.1.19655 WP_000719990.1.19661 WP_000719990.1.19684 WP_000719990.1.19691 WP_000719990.1.19761 WP_000719990.1.19778 WP_000719990.1.19795 WP_000719990.1.1982 WP_000719990.1.19840 WP_000719990.1.19847 WP_000719990.1.19861 WP_000719990.1.1987 WP_000719990.1.19878 WP_000719990.1.19889 WP_000719990.1.19940 WP_000719990.1.19957 WP_000719990.1.19972 WP_000719990.1.19994 WP_000719990.1.2005 WP_000719990.1.20114 WP_000719990.1.20115 WP_000719990.1.20129 WP_000719990.1.20133 WP_000719990.1.20136 WP_000719990.1.2015 WP_000719990.1.20151 WP_000719990.1.20157 WP_000719990.1.20159 WP_000719990.1.20164 WP_000719990.1.20166 WP_000719990.1.20170 WP_000719990.1.20178 WP_000719990.1.20183 WP_000719990.1.20215 WP_000719990.1.20224 WP_000719990.1.20238 WP_000719990.1.20251 WP_000719990.1.20264 WP_000719990.1.2027 WP_000719990.1.20277 WP_000719990.1.20289 WP_000719990.1.20308 WP_000719990.1.20318 WP_000719990.1.20325 WP_000719990.1.20331 WP_000719990.1.20334 WP_000719990.1.20388 WP_000719990.1.20445 WP_000719990.1.20449 WP_000719990.1.20452 WP_000719990.1.20480 WP_000719990.1.20483 WP_000719990.1.20484 WP_000719990.1.20493 WP_000719990.1.20506 WP_000719990.1.20515 WP_000719990.1.20519 WP_000719990.1.20536 WP_000719990.1.20546 WP_000719990.1.20549 WP_000719990.1.20575 WP_000719990.1.20594 WP_000719990.1.20596 WP_000719990.1.20609 WP_000719990.1.2063 WP_000719990.1.20630 WP_000719990.1.20638 WP_000719990.1.20640 WP_000719990.1.20662 WP_000719990.1.20691 WP_000719990.1.20709 WP_000719990.1.20724 WP_000719990.1.20737 WP_000719990.1.20741 WP_000719990.1.20745 WP_000719990.1.20761 WP_000719990.1.20765 WP_000719990.1.20784 WP_000719990.1.20785 WP_000719990.1.20803 WP_000719990.1.20813 WP_000719990.1.20818 WP_000719990.1.20824 WP_000719990.1.20841 WP_000719990.1.20848 WP_000719990.1.20863 WP_000719990.1.20893 WP_000719990.1.20907 WP_000719990.1.20933 WP_000719990.1.2094 WP_000719990.1.20941 WP_000719990.1.20943 WP_000719990.1.20950 WP_000719990.1.20958 WP_000719990.1.20962 WP_000719990.1.20982 WP_000719990.1.20989 WP_000719990.1.2100 WP_000719990.1.21017 WP_000719990.1.21020 WP_000719990.1.21024 WP_000719990.1.21029 WP_000719990.1.21033 WP_000719990.1.21041 WP_000719990.1.21057 WP_000719990.1.21104 WP_000719990.1.21122 WP_000719990.1.21137 WP_000719990.1.21152 WP_000719990.1.21236 WP_000719990.1.21248 WP_000719990.1.21251 WP_000719990.1.21255 WP_000719990.1.21266 WP_000719990.1.21277 WP_000719990.1.21320 WP_000719990.1.21336 WP_000719990.1.21378 WP_000719990.1.2142 WP_000719990.1.21441 WP_000719990.1.21450 WP_000719990.1.21455 WP_000719990.1.21470 WP_000719990.1.21508 WP_000719990.1.21519 WP_000719990.1.21537 WP_000719990.1.2156 WP_000719990.1.21573 WP_000719990.1.21578 WP_000719990.1.21596 WP_000719990.1.21614 WP_000719990.1.21628 WP_000719990.1.21634 WP_000719990.1.21637 WP_000719990.1.21652 WP_000719990.1.21656 WP_000719990.1.21661 WP_000719990.1.21666 WP_000719990.1.21667 WP_000719990.1.21668 WP_000719990.1.21696 WP_000719990.1.21714 WP_000719990.1.21729 WP_000719990.1.21732 WP_000719990.1.21733 WP_000719990.1.21756 WP_000719990.1.21758 WP_000719990.1.21771 WP_000719990.1.21773 WP_000719990.1.21812 WP_000719990.1.21823 WP_000719990.1.21887 WP_000719990.1.21895 WP_000719990.1.21899 WP_000719990.1.21915 WP_000719990.1.21945 WP_000719990.1.21948 WP_000719990.1.21962 WP_000719990.1.2198 WP_000719990.1.21986 WP_000719990.1.21992 WP_000719990.1.22021 WP_000719990.1.22042 WP_000719990.1.22060 WP_000719990.1.22088 WP_000719990.1.22113 WP_000719990.1.22138 WP_000719990.1.22161 WP_000719990.1.2218 WP_000719990.1.22189 WP_000719990.1.22195 WP_000719990.1.22203 WP_000719990.1.22204 WP_000719990.1.22251 WP_000719990.1.22269 WP_000719990.1.22272 WP_000719990.1.22280 WP_000719990.1.22291 WP_000719990.1.22293 WP_000719990.1.22295 WP_000719990.1.22304 WP_000719990.1.22328 WP_000719990.1.22350 WP_000719990.1.22359 WP_000719990.1.22363 WP_000719990.1.22381 WP_000719990.1.22409 WP_000719990.1.2242 WP_000719990.1.22431 WP_000719990.1.2245 WP_000719990.1.22450 WP_000719990.1.22464 WP_000719990.1.22494 WP_000719990.1.22508 WP_000719990.1.22522 WP_000719990.1.22543 WP_000719990.1.22544 WP_000719990.1.22549 WP_000719990.1.22571 WP_000719990.1.22572 WP_000719990.1.22574 WP_000719990.1.22576 WP_000719990.1.22594 WP_000719990.1.22599 WP_000719990.1.22602 WP_000719990.1.22631 WP_000719990.1.22632 WP_000719990.1.22649 WP_000719990.1.22662 WP_000719990.1.22667 WP_000719990.1.22669 WP_000719990.1.22685 WP_000719990.1.22690 WP_000719990.1.22691 WP_000719990.1.22743 WP_000719990.1.22757 WP_000719990.1.22759 WP_000719990.1.22765 WP_000719990.1.22771 WP_000719990.1.22777 WP_000719990.1.22783 WP_000719990.1.22824 WP_000719990.1.22830 WP_000719990.1.22868 WP_000719990.1.22875 WP_000719990.1.22885 WP_000719990.1.22896 WP_000719990.1.22908 WP_000719990.1.22917 WP_000719990.1.22925 WP_000719990.1.22939 WP_000719990.1.22993 WP_000719990.1.2300 WP_000719990.1.23005 WP_000719990.1.23021 WP_000719990.1.23026 WP_000719990.1.23035 WP_000719990.1.23042 WP_000719990.1.23045 WP_000719990.1.23073 WP_000719990.1.23078 WP_000719990.1.23090 WP_000719990.1.23092 WP_000719990.1.23105 WP_000719990.1.23109 WP_000719990.1.23115 WP_000719990.1.23135 WP_000719990.1.2322 WP_000719990.1.23230 WP_000719990.1.23241 WP_000719990.1.2325 WP_000719990.1.23282 WP_000719990.1.23285 WP_000719990.1.23290 WP_000719990.1.23299 WP_000719990.1.23323 WP_000719990.1.23330 WP_000719990.1.23351 WP_000719990.1.23355 WP_000719990.1.23376 WP_000719990.1.23378 WP_000719990.1.23383 WP_000719990.1.23386 WP_000719990.1.23388 WP_000719990.1.23393 WP_000719990.1.23435 WP_000719990.1.23463 WP_000719990.1.23467 WP_000719990.1.23486 WP_000719990.1.23487 WP_000719990.1.23511 WP_000719990.1.23520 WP_000719990.1.23522 WP_000719990.1.23527 WP_000719990.1.23549 WP_000719990.1.23575 WP_000719990.1.23593 WP_000719990.1.2362 WP_000719990.1.23622 WP_000719990.1.23625 WP_000719990.1.23640 WP_000719990.1.23676 WP_000719990.1.23686 WP_000719990.1.23693 WP_000719990.1.23700 WP_000719990.1.23711 WP_000719990.1.23724 WP_000719990.1.23741 WP_000719990.1.23754 WP_000719990.1.23765 WP_000719990.1.23790 WP_000719990.1.23804 WP_000719990.1.23806 WP_000719990.1.23812 WP_000719990.1.23838 WP_000719990.1.23840 WP_000719990.1.23869 WP_000719990.1.2388 WP_000719990.1.23890 WP_000719990.1.23895 WP_000719990.1.23898 WP_000719990.1.23899 WP_000719990.1.23914 WP_000719990.1.23915 WP_000719990.1.23945 WP_000719990.1.2395 WP_000719990.1.23950 WP_000719990.1.23953 WP_000719990.1.23960 WP_000719990.1.23962 WP_000719990.1.23970 WP_000719990.1.23973 WP_000719990.1.23984 WP_000719990.1.23985 WP_000719990.1.24004 WP_000719990.1.24024 WP_000719990.1.24038 WP_000719990.1.24045 WP_000719990.1.24068 WP_000719990.1.24070 WP_000719990.1.24088 WP_000719990.1.24089 WP_000719990.1.24122 WP_000719990.1.24124 WP_000719990.1.24127 WP_000719990.1.24136 WP_000719990.1.24169 WP_000719990.1.24177 WP_000719990.1.2418 WP_000719990.1.24194 WP_000719990.1.24233 WP_000719990.1.24278 WP_000719990.1.2428 WP_000719990.1.24283 WP_000719990.1.2430 WP_000719990.1.24304 WP_000719990.1.24316 WP_000719990.1.2433 WP_000719990.1.24341 WP_000719990.1.24362 WP_000719990.1.24374 WP_000719990.1.24381 WP_000719990.1.24383 WP_000719990.1.24458 WP_000719990.1.24460 WP_000719990.1.24473 WP_000719990.1.24483 WP_000719990.1.24485 WP_000719990.1.2449 WP_000719990.1.24499 WP_000719990.1.24523 WP_000719990.1.24524 WP_000719990.1.24536 WP_000719990.1.24547 WP_000719990.1.24575 WP_000719990.1.24577 WP_000719990.1.24583 WP_000719990.1.24592 WP_000719990.1.24616 WP_000719990.1.24634 WP_000719990.1.24641 WP_000719990.1.24642 WP_000719990.1.24646 WP_000719990.1.24650 WP_000719990.1.2469 WP_000719990.1.24693 WP_000719990.1.24695 WP_000719990.1.24703 WP_000719990.1.24752 WP_000719990.1.24753 WP_000719990.1.24758 WP_000719990.1.24763 WP_000719990.1.24773 WP_000719990.1.2479 WP_000719990.1.24797 WP_000719990.1.24799 WP_000719990.1.24808 WP_000719990.1.24849 WP_000719990.1.24854 WP_000719990.1.24870 WP_000719990.1.24876 WP_000719990.1.24899 WP_000719990.1.24906 WP_000719990.1.24909 WP_000719990.1.24929 WP_000719990.1.24939 WP_000719990.1.24946 WP_000719990.1.24960 WP_000719990.1.24968 WP_000719990.1.24979 WP_000719990.1.24984 WP_000719990.1.25019 WP_000719990.1.2502 WP_000719990.1.25021 WP_000719990.1.25038 WP_000719990.1.25039 WP_000719990.1.2504 WP_000719990.1.25042 WP_000719990.1.25050 WP_000719990.1.25076 WP_000719990.1.25079 WP_000719990.1.25082 WP_000719990.1.25085 WP_000719990.1.25086 WP_000719990.1.25087 WP_000719990.1.25088 WP_000719990.1.2512 WP_000719990.1.25126 WP_000719990.1.25141 WP_000719990.1.25174 WP_000719990.1.25183 WP_000719990.1.25193 WP_000719990.1.25201 WP_000719990.1.25248 WP_000719990.1.25270 WP_000719990.1.25305 WP_000719990.1.2531 WP_000719990.1.25312 WP_000719990.1.25324 WP_000719990.1.2537 WP_000719990.1.25372 WP_000719990.1.25378 WP_000719990.1.25380 WP_000719990.1.2540 WP_000719990.1.25414 WP_000719990.1.25420 WP_000719990.1.2543 WP_000719990.1.25446 WP_000719990.1.25480 WP_000719990.1.255 WP_000719990.1.25525 WP_000719990.1.25526 WP_000719990.1.25548 WP_000719990.1.25577 WP_000719990.1.2558 WP_000719990.1.25592 WP_000719990.1.25612 WP_000719990.1.25613 WP_000719990.1.25631 WP_000719990.1.25643 WP_000719990.1.25652 WP_000719990.1.2567 WP_000719990.1.25680 WP_000719990.1.25701 WP_000719990.1.25712 WP_000719990.1.25713 WP_000719990.1.25724 WP_000719990.1.25726 WP_000719990.1.25750 WP_000719990.1.25794 WP_000719990.1.25799 WP_000719990.1.25819 WP_000719990.1.25831 WP_000719990.1.25832 WP_000719990.1.25843 WP_000719990.1.25869 WP_000719990.1.25873 WP_000719990.1.2588 WP_000719990.1.25886 WP_000719990.1.25895 WP_000719990.1.2597 WP_000719990.1.25996 WP_000719990.1.26005 WP_000719990.1.26040 WP_000719990.1.26048 WP_000719990.1.26055 WP_000719990.1.2606 WP_000719990.1.26061 WP_000719990.1.26066 WP_000719990.1.26076 WP_000719990.1.26092 WP_000719990.1.26100 WP_000719990.1.26105 WP_000719990.1.2612 WP_000719990.1.26121 WP_000719990.1.26125 WP_000719990.1.26130 WP_000719990.1.26131 WP_000719990.1.26134 WP_000719990.1.26150 WP_000719990.1.26161 WP_000719990.1.26175 WP_000719990.1.26186 WP_000719990.1.26189 WP_000719990.1.26191 WP_000719990.1.26196 WP_000719990.1.26246 WP_000719990.1.26259 WP_000719990.1.26264 WP_000719990.1.26270 WP_000719990.1.26284 WP_000719990.1.26304 WP_000719990.1.26325 WP_000719990.1.2637 WP_000719990.1.26379 WP_000719990.1.26391 WP_000719990.1.26398 WP_000719990.1.26403 WP_000719990.1.26419 WP_000719990.1.2642 WP_000719990.1.26438 WP_000719990.1.26467 WP_000719990.1.26474 WP_000719990.1.26479 WP_000719990.1.26480 WP_000719990.1.26517 WP_000719990.1.26525 WP_000719990.1.26569 WP_000719990.1.26574 WP_000719990.1.26575 WP_000719990.1.26579 WP_000719990.1.26588 WP_000719990.1.26590 WP_000719990.1.26609 WP_000719990.1.26613 WP_000719990.1.26627 WP_000719990.1.2665 WP_000719990.1.26658 WP_000719990.1.26659 WP_000719990.1.26660 WP_000719990.1.26683 WP_000719990.1.26688 WP_000719990.1.26716 WP_000719990.1.26720 WP_000719990.1.26736 WP_000719990.1.26761 WP_000719990.1.26782 WP_000719990.1.26837 WP_000719990.1.26861 WP_000719990.1.26878 WP_000719990.1.2688 WP_000719990.1.26912 WP_000719990.1.26932 WP_000719990.1.2694 WP_000719990.1.26941 WP_000719990.1.26943 WP_000719990.1.2695 WP_000719990.1.26950 WP_000719990.1.26975 WP_000719990.1.26987 WP_000719990.1.26995 WP_000719990.1.26998 WP_000719990.1.2700 WP_000719990.1.27019 WP_000719990.1.27043 WP_000719990.1.27057 WP_000719990.1.27060 WP_000719990.1.27091 WP_000719990.1.27098 WP_000719990.1.27101 WP_000719990.1.2712 WP_000719990.1.27134 WP_000719990.1.27141 WP_000719990.1.27148 WP_000719990.1.27175 WP_000719990.1.27188 WP_000719990.1.27214 WP_000719990.1.27234 WP_000719990.1.27260 WP_000719990.1.27283 WP_000719990.1.27287 WP_000719990.1.27292 WP_000719990.1.2731 WP_000719990.1.27310 WP_000719990.1.27313 WP_000719990.1.27330 WP_000719990.1.27338 WP_000719990.1.27373 WP_000719990.1.27401 WP_000719990.1.27424 WP_000719990.1.27426 WP_000719990.1.27445 WP_000719990.1.2745 WP_000719990.1.27451 WP_000719990.1.27472 WP_000719990.1.27504 WP_000719990.1.27518 WP_000719990.1.27520 WP_000719990.1.2755 WP_000719990.1.27560 WP_000719990.1.27580 WP_000719990.1.27585 WP_000719990.1.27611 WP_000719990.1.27618 WP_000719990.1.27691 WP_000719990.1.27693 WP_000719990.1.27698 WP_000719990.1.27723 WP_000719990.1.27741 WP_000719990.1.27742 WP_000719990.1.27749 WP_000719990.1.27758 WP_000719990.1.27774 WP_000719990.1.2779 WP_000719990.1.27797 WP_000719990.1.2782 WP_000719990.1.27846 WP_000719990.1.27856 WP_000719990.1.27861 WP_000719990.1.27871 WP_000719990.1.27876 WP_000719990.1.27879 WP_000719990.1.27897 WP_000719990.1.27911 WP_000719990.1.27913 WP_000719990.1.27923 WP_000719990.1.27932 WP_000719990.1.2794 WP_000719990.1.27957 WP_000719990.1.27971 WP_000719990.1.27998 WP_000719990.1.28008 WP_000719990.1.28026 WP_000719990.1.28046 WP_000719990.1.28051 WP_000719990.1.28109 WP_000719990.1.2811 WP_000719990.1.28110 WP_000719990.1.28128 WP_000719990.1.28143 WP_000719990.1.28145 WP_000719990.1.28156 WP_000719990.1.28184 WP_000719990.1.28199 WP_000719990.1.2823 WP_000719990.1.28250 WP_000719990.1.2826 WP_000719990.1.28268 WP_000719990.1.28271 WP_000719990.1.28314 WP_000719990.1.28318 WP_000719990.1.28322 WP_000719990.1.28345 WP_000719990.1.28349 WP_000719990.1.28371 WP_000719990.1.2838 WP_000719990.1.28401 WP_000719990.1.28440 WP_000719990.1.28461 WP_000719990.1.28476 WP_000719990.1.28480 WP_000719990.1.28491 WP_000719990.1.285 WP_000719990.1.28500 WP_000719990.1.28509 WP_000719990.1.28523 WP_000719990.1.28536 WP_000719990.1.28540 WP_000719990.1.28544 WP_000719990.1.28551 WP_000719990.1.28554 WP_000719990.1.28568 WP_000719990.1.2866 WP_000719990.1.28662 WP_000719990.1.28683 WP_000719990.1.28697 WP_000719990.1.28711 WP_000719990.1.28723 WP_000719990.1.28732 WP_000719990.1.28734 WP_000719990.1.28736 WP_000719990.1.28742 WP_000719990.1.28760 WP_000719990.1.28762 WP_000719990.1.28809 WP_000719990.1.2881 WP_000719990.1.28829 WP_000719990.1.28842 WP_000719990.1.28863 WP_000719990.1.28879 WP_000719990.1.28919 WP_000719990.1.28924 WP_000719990.1.28950 WP_000719990.1.28953 WP_000719990.1.28982 WP_000719990.1.28994 WP_000719990.1.290 WP_000719990.1.29001 WP_000719990.1.29016 WP_000719990.1.29026 WP_000719990.1.29049 WP_000719990.1.29055 WP_000719990.1.29061 WP_000719990.1.29082 WP_000719990.1.291 WP_000719990.1.29100 WP_000719990.1.29118 WP_000719990.1.29125 WP_000719990.1.29126 WP_000719990.1.29128 WP_000719990.1.29150 WP_000719990.1.29164 WP_000719990.1.29176 WP_000719990.1.29194 WP_000719990.1.29202 WP_000719990.1.29206 WP_000719990.1.29221 WP_000719990.1.29239 WP_000719990.1.29252 WP_000719990.1.29258 WP_000719990.1.2926 WP_000719990.1.2931 WP_000719990.1.29341 WP_000719990.1.29377 WP_000719990.1.29394 WP_000719990.1.29404 WP_000719990.1.2942 WP_000719990.1.29429 WP_000719990.1.29443 WP_000719990.1.2945 WP_000719990.1.29486 WP_000719990.1.29495 WP_000719990.1.29497 WP_000719990.1.29503 WP_000719990.1.29504 WP_000719990.1.29513 WP_000719990.1.2952 WP_000719990.1.29523 WP_000719990.1.2954 WP_000719990.1.29564 WP_000719990.1.29590 WP_000719990.1.29597 WP_000719990.1.29603 WP_000719990.1.29618 WP_000719990.1.2963 WP_000719990.1.29647 WP_000719990.1.29662 WP_000719990.1.29669 WP_000719990.1.29683 WP_000719990.1.29689 WP_000719990.1.29715 WP_000719990.1.29746 WP_000719990.1.2978 WP_000719990.1.29798 WP_000719990.1.29812 WP_000719990.1.29815 WP_000719990.1.29818 WP_000719990.1.29819 WP_000719990.1.29820 WP_000719990.1.29821 WP_000719990.1.29840 WP_000719990.1.29855 WP_000719990.1.29874 WP_000719990.1.29876 WP_000719990.1.29884 WP_000719990.1.2995 WP_000719990.1.29967 WP_000719990.1.29976 WP_000719990.1.29979 WP_000719990.1.29988 WP_000719990.1.29992 WP_000719990.1.30 WP_000719990.1.30004 WP_000719990.1.30019 WP_000719990.1.30035 WP_000719990.1.30052 WP_000719990.1.30063 WP_000719990.1.30064 WP_000719990.1.30098 WP_000719990.1.30105 WP_000719990.1.30123 WP_000719990.1.30164 WP_000719990.1.3018 WP_000719990.1.30231 WP_000719990.1.30232 WP_000719990.1.30239 WP_000719990.1.30247 WP_000719990.1.30253 WP_000719990.1.30269 WP_000719990.1.30298 WP_000719990.1.30391 WP_000719990.1.30397 WP_000719990.1.30399 WP_000719990.1.30400 WP_000719990.1.30428 WP_000719990.1.30447 WP_000719990.1.3045 WP_000719990.1.30452 WP_000719990.1.30472 WP_000719990.1.30476 WP_000719990.1.30479 WP_000719990.1.30497 WP_000719990.1.30524 WP_000719990.1.30536 WP_000719990.1.30546 WP_000719990.1.3055 WP_000719990.1.30550 WP_000719990.1.30570 WP_000719990.1.30580 WP_000719990.1.306 WP_000719990.1.3063 WP_000719990.1.30630 WP_000719990.1.30637 WP_000719990.1.30639 WP_000719990.1.30640 WP_000719990.1.30658 WP_000719990.1.30665 WP_000719990.1.30691 WP_000719990.1.30733 WP_000719990.1.30742 WP_000719990.1.30762 WP_000719990.1.30783 WP_000719990.1.30808 WP_000719990.1.3083 WP_000719990.1.30843 WP_000719990.1.30867 WP_000719990.1.30879 WP_000719990.1.30887 WP_000719990.1.30896 WP_000719990.1.309 WP_000719990.1.30905 WP_000719990.1.30906 WP_000719990.1.30918 WP_000719990.1.30987 WP_000719990.1.30993 WP_000719990.1.30999 WP_000719990.1.31000 WP_000719990.1.31017 WP_000719990.1.31029 WP_000719990.1.31055 WP_000719990.1.31083 WP_000719990.1.31089 WP_000719990.1.31119 WP_000719990.1.31129 WP_000719990.1.31142 WP_000719990.1.31154 WP_000719990.1.31188 WP_000719990.1.312 WP_000719990.1.31211 WP_000719990.1.31252 WP_000719990.1.31295 WP_000719990.1.31319 WP_000719990.1.31340 WP_000719990.1.31357 WP_000719990.1.31379 WP_000719990.1.3140 WP_000719990.1.31401 WP_000719990.1.31407 WP_000719990.1.31419 WP_000719990.1.31421 WP_000719990.1.31422 WP_000719990.1.31429 WP_000719990.1.31431 WP_000719990.1.31433 WP_000719990.1.3147 WP_000719990.1.31506 WP_000719990.1.31511 WP_000719990.1.31518 WP_000719990.1.31557 WP_000719990.1.31559 WP_000719990.1.31575 WP_000719990.1.31596 WP_000719990.1.31614 WP_000719990.1.31618 WP_000719990.1.31639 WP_000719990.1.31657 WP_000719990.1.31675 WP_000719990.1.31679 WP_000719990.1.31681 WP_000719990.1.3169 WP_000719990.1.31709 WP_000719990.1.31715 WP_000719990.1.31740 WP_000719990.1.3176 WP_000719990.1.31803 WP_000719990.1.3181 WP_000719990.1.31823 WP_000719990.1.31825 WP_000719990.1.31833 WP_000719990.1.31835 WP_000719990.1.31839 WP_000719990.1.31860 WP_000719990.1.31863 WP_000719990.1.31866 WP_000719990.1.31898 WP_000719990.1.31924 WP_000719990.1.31928 WP_000719990.1.3193 WP_000719990.1.31956 WP_000719990.1.31978 WP_000719990.1.3201 WP_000719990.1.32020 WP_000719990.1.32021 WP_000719990.1.32024 WP_000719990.1.3203 WP_000719990.1.32030 WP_000719990.1.32037 WP_000719990.1.32063 WP_000719990.1.32091 WP_000719990.1.32093 WP_000719990.1.32094 WP_000719990.1.3212 WP_000719990.1.32121 WP_000719990.1.32138 WP_000719990.1.32142 WP_000719990.1.32143 WP_000719990.1.32173 WP_000719990.1.32184 WP_000719990.1.322 WP_000719990.1.32222 WP_000719990.1.32225 WP_000719990.1.32232 WP_000719990.1.32234 WP_000719990.1.32236 WP_000719990.1.32243 WP_000719990.1.32279 WP_000719990.1.32287 WP_000719990.1.3233 WP_000719990.1.32394 WP_000719990.1.32406 WP_000719990.1.32432 WP_000719990.1.3247 WP_000719990.1.32475 WP_000719990.1.32478 WP_000719990.1.32479 WP_000719990.1.3248 WP_000719990.1.32480 WP_000719990.1.32509 WP_000719990.1.32518 WP_000719990.1.32536 WP_000719990.1.32561 WP_000719990.1.32574 WP_000719990.1.32580 WP_000719990.1.3259 WP_000719990.1.32590 WP_000719990.1.32591 WP_000719990.1.32601 WP_000719990.1.32635 WP_000719990.1.32650 WP_000719990.1.32655 WP_000719990.1.32661 WP_000719990.1.32676 WP_000719990.1.32680 WP_000719990.1.3269 WP_000719990.1.32709 WP_000719990.1.32718 WP_000719990.1.32720 WP_000719990.1.32722 WP_000719990.1.32724 WP_000719990.1.32748 WP_000719990.1.32772 WP_000719990.1.32811 WP_000719990.1.32815 WP_000719990.1.32831 WP_000719990.1.32835 WP_000719990.1.32875 WP_000719990.1.32888 WP_000719990.1.32903 WP_000719990.1.32910 WP_000719990.1.32931 WP_000719990.1.32938 WP_000719990.1.32946 WP_000719990.1.3295 WP_000719990.1.32959 WP_000719990.1.32972 WP_000719990.1.32984 WP_000719990.1.32992 WP_000719990.1.32995 WP_000719990.1.33004 WP_000719990.1.33014 WP_000719990.1.33018 WP_000719990.1.33022 WP_000719990.1.33026 WP_000719990.1.33046 WP_000719990.1.33049 WP_000719990.1.33053 WP_000719990.1.33055 WP_000719990.1.33094 WP_000719990.1.33119 WP_000719990.1.33125 WP_000719990.1.33146 WP_000719990.1.33167 WP_000719990.1.33178 WP_000719990.1.33179 WP_000719990.1.33190 WP_000719990.1.33217 WP_000719990.1.33222 WP_000719990.1.3323 WP_000719990.1.33237 WP_000719990.1.33238 WP_000719990.1.33244 WP_000719990.1.33268 WP_000719990.1.33303 WP_000719990.1.33325 WP_000719990.1.33341 WP_000719990.1.33352 WP_000719990.1.334 WP_000719990.1.33408 WP_000719990.1.33410 WP_000719990.1.33422 WP_000719990.1.33424 WP_000719990.1.33428 WP_000719990.1.3344 WP_000719990.1.33475 WP_000719990.1.33476 WP_000719990.1.33502 WP_000719990.1.33512 WP_000719990.1.33525 WP_000719990.1.33526 WP_000719990.1.3354 WP_000719990.1.33545 WP_000719990.1.33563 WP_000719990.1.33565 WP_000719990.1.33584 WP_000719990.1.33595 WP_000719990.1.33631 WP_000719990.1.33638 WP_000719990.1.33648 WP_000719990.1.33667 WP_000719990.1.33680 WP_000719990.1.33736 WP_000719990.1.33745 WP_000719990.1.33746 WP_000719990.1.33751 WP_000719990.1.33799 WP_000719990.1.33823 WP_000719990.1.33854 WP_000719990.1.33879 WP_000719990.1.33888 WP_000719990.1.33914 WP_000719990.1.33948 WP_000719990.1.33952 WP_000719990.1.33973 WP_000719990.1.33974 WP_000719990.1.33979 WP_000719990.1.3398 WP_000719990.1.33981 WP_000719990.1.3401 WP_000719990.1.34094 WP_000719990.1.3411 WP_000719990.1.34117 WP_000719990.1.34121 WP_000719990.1.34122 WP_000719990.1.34124 WP_000719990.1.34130 WP_000719990.1.342 WP_000719990.1.34204 WP_000719990.1.34206 WP_000719990.1.34208 WP_000719990.1.34224 WP_000719990.1.34269 WP_000719990.1.34270 WP_000719990.1.34273 WP_000719990.1.34277 WP_000719990.1.34294 WP_000719990.1.34303 WP_000719990.1.3432 WP_000719990.1.34332 WP_000719990.1.34341 WP_000719990.1.34362 WP_000719990.1.34363 WP_000719990.1.34383 WP_000719990.1.3439 WP_000719990.1.34397 WP_000719990.1.34400 WP_000719990.1.34422 WP_000719990.1.3444 WP_000719990.1.34440 WP_000719990.1.34441 WP_000719990.1.34444 WP_000719990.1.34456 WP_000719990.1.34500 WP_000719990.1.34525 WP_000719990.1.34528 WP_000719990.1.34532 WP_000719990.1.34538 WP_000719990.1.3460 WP_000719990.1.34605 WP_000719990.1.34617 WP_000719990.1.34680 WP_000719990.1.34682 WP_000719990.1.34683 WP_000719990.1.34686 WP_000719990.1.3469 WP_000719990.1.347 WP_000719990.1.3472 WP_000719990.1.34727 WP_000719990.1.34763 WP_000719990.1.34781 WP_000719990.1.34794 WP_000719990.1.34827 WP_000719990.1.34835 WP_000719990.1.34838 WP_000719990.1.34855 WP_000719990.1.34875 WP_000719990.1.34887 WP_000719990.1.34913 WP_000719990.1.34931 WP_000719990.1.34982 WP_000719990.1.34993 WP_000719990.1.35003 WP_000719990.1.35007 WP_000719990.1.35012 WP_000719990.1.35039 WP_000719990.1.35107 WP_000719990.1.35114 WP_000719990.1.35127 WP_000719990.1.3515 WP_000719990.1.35180 WP_000719990.1.35186 WP_000719990.1.35195 WP_000719990.1.35198 WP_000719990.1.35202 WP_000719990.1.35204 WP_000719990.1.35211 WP_000719990.1.35220 WP_000719990.1.35253 WP_000719990.1.35258 WP_000719990.1.35316 WP_000719990.1.35328 WP_000719990.1.35360 WP_000719990.1.35365 WP_000719990.1.35368 WP_000719990.1.35376 WP_000719990.1.35393 WP_000719990.1.35394 WP_000719990.1.35398 WP_000719990.1.35448 WP_000719990.1.35464 WP_000719990.1.35465 WP_000719990.1.35466 WP_000719990.1.35468 WP_000719990.1.35483 WP_000719990.1.3550 WP_000719990.1.35552 WP_000719990.1.35578 WP_000719990.1.35604 WP_000719990.1.35627 WP_000719990.1.35632 WP_000719990.1.35649 WP_000719990.1.35651 WP_000719990.1.35653 WP_000719990.1.35698 WP_000719990.1.35704 WP_000719990.1.35724 WP_000719990.1.35741 WP_000719990.1.35744 WP_000719990.1.35789 WP_000719990.1.35889 WP_000719990.1.35904 WP_000719990.1.35922 WP_000719990.1.35927 WP_000719990.1.35934 WP_000719990.1.35942 WP_000719990.1.35959 WP_000719990.1.35963 WP_000719990.1.3598 WP_000719990.1.35987 WP_000719990.1.35990 WP_000719990.1.3600 WP_000719990.1.36010 WP_000719990.1.36040 WP_000719990.1.36042 WP_000719990.1.36070 WP_000719990.1.36071 WP_000719990.1.36085 WP_000719990.1.36094 WP_000719990.1.36129 WP_000719990.1.36132 WP_000719990.1.36158 WP_000719990.1.36164 WP_000719990.1.36166 WP_000719990.1.36177 WP_000719990.1.3620 WP_000719990.1.36207 WP_000719990.1.36212 WP_000719990.1.3624 WP_000719990.1.36332 WP_000719990.1.36334 WP_000719990.1.36352 WP_000719990.1.36386 WP_000719990.1.36405 WP_000719990.1.36412 WP_000719990.1.36414 WP_000719990.1.36426 WP_000719990.1.3643 WP_000719990.1.36453 WP_000719990.1.36459 WP_000719990.1.36496 WP_000719990.1.365 WP_000719990.1.36507 WP_000719990.1.36523 WP_000719990.1.36531 WP_000719990.1.36545 WP_000719990.1.36610 WP_000719990.1.36626 WP_000719990.1.36627 WP_000719990.1.36628 WP_000719990.1.36667 WP_000719990.1.36699 WP_000719990.1.36707 WP_000719990.1.3671 WP_000719990.1.36724 WP_000719990.1.36739 WP_000719990.1.36746 WP_000719990.1.36747 WP_000719990.1.36761 WP_000719990.1.36767 WP_000719990.1.36799 WP_000719990.1.36812 WP_000719990.1.36817 WP_000719990.1.36826 WP_000719990.1.36833 WP_000719990.1.36856 WP_000719990.1.36894 WP_000719990.1.36904 WP_000719990.1.36925 WP_000719990.1.3697 WP_000719990.1.36975 WP_000719990.1.37006 WP_000719990.1.37020 WP_000719990.1.37032 WP_000719990.1.37046 WP_000719990.1.37049 WP_000719990.1.37099 WP_000719990.1.37102 WP_000719990.1.37103 WP_000719990.1.37122 WP_000719990.1.37146 WP_000719990.1.37153 WP_000719990.1.37155 WP_000719990.1.37206 WP_000719990.1.37226 WP_000719990.1.3723 WP_000719990.1.37233 WP_000719990.1.37252 WP_000719990.1.37261 WP_000719990.1.37266 WP_000719990.1.37290 WP_000719990.1.37306 WP_000719990.1.37312 WP_000719990.1.37313 WP_000719990.1.37329 WP_000719990.1.37334 WP_000719990.1.37337 WP_000719990.1.37342 WP_000719990.1.37352 WP_000719990.1.37360 WP_000719990.1.37371 WP_000719990.1.37372 WP_000719990.1.37388 WP_000719990.1.37419 WP_000719990.1.37423 WP_000719990.1.37433 WP_000719990.1.37445 WP_000719990.1.37476 WP_000719990.1.37477 WP_000719990.1.37485 WP_000719990.1.37510 WP_000719990.1.37538 WP_000719990.1.37544 WP_000719990.1.37548 WP_000719990.1.37549 WP_000719990.1.37550 WP_000719990.1.37554 WP_000719990.1.37576 WP_000719990.1.37588 WP_000719990.1.37592 WP_000719990.1.37608 WP_000719990.1.3762 WP_000719990.1.37634 WP_000719990.1.37637 WP_000719990.1.37664 WP_000719990.1.377 WP_000719990.1.3772 WP_000719990.1.37730 WP_000719990.1.37731 WP_000719990.1.37736 WP_000719990.1.37745 WP_000719990.1.37750 WP_000719990.1.37758 WP_000719990.1.37766 WP_000719990.1.37769 WP_000719990.1.37773 WP_000719990.1.37817 WP_000719990.1.37847 WP_000719990.1.37852 WP_000719990.1.37853 WP_000719990.1.3788 WP_000719990.1.37880 WP_000719990.1.37887 WP_000719990.1.37897 WP_000719990.1.37917 WP_000719990.1.37923 WP_000719990.1.37926 WP_000719990.1.3795 WP_000719990.1.3796 WP_000719990.1.37962 WP_000719990.1.37964 WP_000719990.1.37967 WP_000719990.1.37984 WP_000719990.1.37995 WP_000719990.1.37998 WP_000719990.1.38000 WP_000719990.1.38033 WP_000719990.1.38043 WP_000719990.1.38050 WP_000719990.1.38063 WP_000719990.1.38080 WP_000719990.1.38081 WP_000719990.1.38085 WP_000719990.1.38103 WP_000719990.1.38105 WP_000719990.1.38107 WP_000719990.1.3811 WP_000719990.1.38119 WP_000719990.1.38120 WP_000719990.1.3815 WP_000719990.1.38155 WP_000719990.1.38162 WP_000719990.1.38182 WP_000719990.1.38185 WP_000719990.1.38194 WP_000719990.1.38202 WP_000719990.1.38211 WP_000719990.1.3822 WP_000719990.1.38234 WP_000719990.1.38257 WP_000719990.1.38293 WP_000719990.1.38300 WP_000719990.1.38306 WP_000719990.1.38314 WP_000719990.1.38323 WP_000719990.1.38357 WP_000719990.1.38363 WP_000719990.1.38369 WP_000719990.1.38371 WP_000719990.1.38412 WP_000719990.1.38485 WP_000719990.1.38533 WP_000719990.1.38544 WP_000719990.1.38561 WP_000719990.1.38567 WP_000719990.1.38584 WP_000719990.1.38626 WP_000719990.1.38629 WP_000719990.1.38636 WP_000719990.1.38694 WP_000719990.1.38722 WP_000719990.1.3873 WP_000719990.1.38751 WP_000719990.1.38777 WP_000719990.1.38782 WP_000719990.1.38811 WP_000719990.1.38827 WP_000719990.1.38835 WP_000719990.1.38843 WP_000719990.1.38896 WP_000719990.1.389 WP_000719990.1.38911 WP_000719990.1.38920 WP_000719990.1.38935 WP_000719990.1.38937 WP_000719990.1.38950 WP_000719990.1.38956 WP_000719990.1.38958 WP_000719990.1.39005 WP_000719990.1.39037 WP_000719990.1.3904 WP_000719990.1.39042 WP_000719990.1.39063 WP_000719990.1.39103 WP_000719990.1.3912 WP_000719990.1.39123 WP_000719990.1.39148 WP_000719990.1.39150 WP_000719990.1.39155 WP_000719990.1.39164 WP_000719990.1.39167 WP_000719990.1.39171 WP_000719990.1.39180 WP_000719990.1.39184 WP_000719990.1.39196 WP_000719990.1.39209 WP_000719990.1.3921 WP_000719990.1.39232 WP_000719990.1.39254 WP_000719990.1.39268 WP_000719990.1.39289 WP_000719990.1.39302 WP_000719990.1.39310 WP_000719990.1.39313 WP_000719990.1.39325 WP_000719990.1.39327 WP_000719990.1.39356 WP_000719990.1.39358 WP_000719990.1.39365 WP_000719990.1.39367 WP_000719990.1.39377 WP_000719990.1.39401 WP_000719990.1.39402 WP_000719990.1.39415 WP_000719990.1.39423 WP_000719990.1.39481 WP_000719990.1.39492 WP_000719990.1.39509 WP_000719990.1.39531 WP_000719990.1.3954 WP_000719990.1.39541 WP_000719990.1.39564 WP_000719990.1.39575 WP_000719990.1.39594 WP_000719990.1.39601 WP_000719990.1.39606 WP_000719990.1.39607 WP_000719990.1.39610 WP_000719990.1.39626 WP_000719990.1.39636 WP_000719990.1.39646 WP_000719990.1.39651 WP_000719990.1.39690 WP_000719990.1.3970 WP_000719990.1.39708 WP_000719990.1.39709 WP_000719990.1.39713 WP_000719990.1.39715 WP_000719990.1.39717 WP_000719990.1.39726 WP_000719990.1.39733 WP_000719990.1.39734 WP_000719990.1.39758 WP_000719990.1.39780 WP_000719990.1.39796 WP_000719990.1.3980 WP_000719990.1.39809 WP_000719990.1.39818 WP_000719990.1.39820 WP_000719990.1.39822 WP_000719990.1.39829 WP_000719990.1.39867 WP_000719990.1.39870 WP_000719990.1.39892 WP_000719990.1.39938 WP_000719990.1.39961 WP_000719990.1.39966 WP_000719990.1.39970 WP_000719990.1.39973 WP_000719990.1.39992 WP_000719990.1.39998 WP_000719990.1.40 WP_000719990.1.40013 WP_000719990.1.40016 WP_000719990.1.40019 WP_000719990.1.40083 WP_000719990.1.40088 WP_000719990.1.40107 WP_000719990.1.40113 WP_000719990.1.40140 WP_000719990.1.40147 WP_000719990.1.40153 WP_000719990.1.40190 WP_000719990.1.40192 WP_000719990.1.4020 WP_000719990.1.40206 WP_000719990.1.40211 WP_000719990.1.40212 WP_000719990.1.40218 WP_000719990.1.40234 WP_000719990.1.40238 WP_000719990.1.40249 WP_000719990.1.40298 WP_000719990.1.4030 WP_000719990.1.40300 WP_000719990.1.40315 WP_000719990.1.40317 WP_000719990.1.40319 WP_000719990.1.40335 WP_000719990.1.40345 WP_000719990.1.40349 WP_000719990.1.40360 WP_000719990.1.40382 WP_000719990.1.40389 WP_000719990.1.40391 WP_000719990.1.40403 WP_000719990.1.40445 WP_000719990.1.40486 WP_000719990.1.4049 WP_000719990.1.40499 WP_000719990.1.40502 WP_000719990.1.40509 WP_000719990.1.40524 WP_000719990.1.40539 WP_000719990.1.40548 WP_000719990.1.40549 WP_000719990.1.40560 WP_000719990.1.40563 WP_000719990.1.40596 WP_000719990.1.40599 WP_000719990.1.406 WP_000719990.1.40617 WP_000719990.1.40629 WP_000719990.1.40636 WP_000719990.1.40657 WP_000719990.1.40660 WP_000719990.1.40666 WP_000719990.1.40686 WP_000719990.1.40712 WP_000719990.1.40715 WP_000719990.1.40742 WP_000719990.1.40758 WP_000719990.1.40781 WP_000719990.1.40793 WP_000719990.1.40813 WP_000719990.1.40815 WP_000719990.1.4082 WP_000719990.1.40833 WP_000719990.1.40842 WP_000719990.1.40843 WP_000719990.1.40865 WP_000719990.1.40882 WP_000719990.1.40898 WP_000719990.1.40900 WP_000719990.1.40912 WP_000719990.1.40937 WP_000719990.1.40952 WP_000719990.1.40965 WP_000719990.1.4103 WP_000719990.1.41037 WP_000719990.1.41041 WP_000719990.1.41045 WP_000719990.1.41060 WP_000719990.1.41063 WP_000719990.1.41078 WP_000719990.1.41113 WP_000719990.1.41125 WP_000719990.1.41147 WP_000719990.1.41206 WP_000719990.1.4122 WP_000719990.1.41239 WP_000719990.1.4126 WP_000719990.1.41263 WP_000719990.1.41287 WP_000719990.1.41294 WP_000719990.1.41315 WP_000719990.1.41330 WP_000719990.1.41332 WP_000719990.1.41339 WP_000719990.1.41346 WP_000719990.1.41363 WP_000719990.1.41368 WP_000719990.1.41371 WP_000719990.1.41372 WP_000719990.1.41391 WP_000719990.1.41392 WP_000719990.1.41394 WP_000719990.1.41401 WP_000719990.1.41402 WP_000719990.1.41407 WP_000719990.1.41417 WP_000719990.1.4142 WP_000719990.1.41436 WP_000719990.1.41449 WP_000719990.1.41453 WP_000719990.1.41455 WP_000719990.1.41466 WP_000719990.1.41478 WP_000719990.1.41479 WP_000719990.1.41481 WP_000719990.1.41482 WP_000719990.1.41483 WP_000719990.1.41484 WP_000719990.1.41488 WP_000719990.1.41513 WP_000719990.1.41530 WP_000719990.1.41536 WP_000719990.1.41545 WP_000719990.1.41556 WP_000719990.1.41566 WP_000719990.1.4158 WP_000719990.1.41613 WP_000719990.1.41621 WP_000719990.1.41651 WP_000719990.1.41654 WP_000719990.1.41712 WP_000719990.1.4172 WP_000719990.1.41734 WP_000719990.1.41741 WP_000719990.1.41752 WP_000719990.1.41780 WP_000719990.1.41782 WP_000719990.1.41783 WP_000719990.1.41784 WP_000719990.1.41812 WP_000719990.1.41813 WP_000719990.1.41822 WP_000719990.1.41826 WP_000719990.1.41837 WP_000719990.1.41847 WP_000719990.1.41849 WP_000719990.1.41884 WP_000719990.1.41885 WP_000719990.1.4189 WP_000719990.1.41900 WP_000719990.1.41923 WP_000719990.1.4193 WP_000719990.1.41956 WP_000719990.1.41960 WP_000719990.1.41964 WP_000719990.1.41988 WP_000719990.1.41990 WP_000719990.1.41991 WP_000719990.1.42022 WP_000719990.1.42027 WP_000719990.1.42033 WP_000719990.1.42036 WP_000719990.1.42038 WP_000719990.1.42044 WP_000719990.1.42060 WP_000719990.1.42073 WP_000719990.1.42113 WP_000719990.1.4213 WP_000719990.1.42138 WP_000719990.1.4214 WP_000719990.1.42159 WP_000719990.1.42179 WP_000719990.1.42191 WP_000719990.1.42203 WP_000719990.1.42209 WP_000719990.1.42214 WP_000719990.1.42221 WP_000719990.1.42226 WP_000719990.1.42228 WP_000719990.1.42233 WP_000719990.1.4224 WP_000719990.1.42252 WP_000719990.1.42258 WP_000719990.1.42318 WP_000719990.1.42350 WP_000719990.1.42367 WP_000719990.1.42376 WP_000719990.1.42387 WP_000719990.1.42413 WP_000719990.1.42415 WP_000719990.1.4242 WP_000719990.1.42432 WP_000719990.1.42442 WP_000719990.1.42447 WP_000719990.1.42448 WP_000719990.1.42456 WP_000719990.1.42480 WP_000719990.1.4250 WP_000719990.1.42513 WP_000719990.1.42516 WP_000719990.1.42522 WP_000719990.1.42586 WP_000719990.1.42594 WP_000719990.1.42597 WP_000719990.1.42600 WP_000719990.1.42601 WP_000719990.1.4261 WP_000719990.1.42632 WP_000719990.1.42638 WP_000719990.1.42661 WP_000719990.1.42669 WP_000719990.1.42670 WP_000719990.1.42677 WP_000719990.1.42709 WP_000719990.1.42728 WP_000719990.1.42748 WP_000719990.1.42749 WP_000719990.1.42756 WP_000719990.1.42770 WP_000719990.1.42771 WP_000719990.1.42804 WP_000719990.1.42808 WP_000719990.1.42813 WP_000719990.1.4282 WP_000719990.1.42832 WP_000719990.1.42863 WP_000719990.1.42879 WP_000719990.1.42891 WP_000719990.1.4290 WP_000719990.1.42903 WP_000719990.1.42918 WP_000719990.1.42936 WP_000719990.1.42937 WP_000719990.1.42962 WP_000719990.1.42970 WP_000719990.1.42975 WP_000719990.1.42987 WP_000719990.1.42989 WP_000719990.1.42991 WP_000719990.1.43013 WP_000719990.1.43027 WP_000719990.1.43035 WP_000719990.1.4306 WP_000719990.1.43079 WP_000719990.1.43121 WP_000719990.1.4313 WP_000719990.1.43132 WP_000719990.1.43137 WP_000719990.1.43140 WP_000719990.1.43170 WP_000719990.1.43174 WP_000719990.1.43177 WP_000719990.1.43196 WP_000719990.1.43213 WP_000719990.1.43216 WP_000719990.1.43270 WP_000719990.1.43278 WP_000719990.1.43316 WP_000719990.1.4334 WP_000719990.1.43363 WP_000719990.1.43384 WP_000719990.1.4342 WP_000719990.1.43422 WP_000719990.1.43427 WP_000719990.1.4343 WP_000719990.1.43444 WP_000719990.1.43448 WP_000719990.1.43455 WP_000719990.1.43469 WP_000719990.1.43473 WP_000719990.1.43474 WP_000719990.1.43489 WP_000719990.1.43501 WP_000719990.1.43536 WP_000719990.1.4356 WP_000719990.1.43561 WP_000719990.1.43598 WP_000719990.1.43604 WP_000719990.1.43622 WP_000719990.1.43642 WP_000719990.1.43720 WP_000719990.1.43733 WP_000719990.1.43738 WP_000719990.1.43750 WP_000719990.1.43754 WP_000719990.1.43769 WP_000719990.1.43798 WP_000719990.1.43803 WP_000719990.1.43804 WP_000719990.1.43816 WP_000719990.1.43837 WP_000719990.1.43858 WP_000719990.1.43868 WP_000719990.1.43911 WP_000719990.1.43918 WP_000719990.1.43925 WP_000719990.1.43939 WP_000719990.1.43942 WP_000719990.1.43953 WP_000719990.1.43966 WP_000719990.1.43989 WP_000719990.1.440 WP_000719990.1.44018 WP_000719990.1.44029 WP_000719990.1.44040 WP_000719990.1.44051 WP_000719990.1.44075 WP_000719990.1.44077 WP_000719990.1.44088 WP_000719990.1.44096 WP_000719990.1.44100 WP_000719990.1.4411 WP_000719990.1.44115 WP_000719990.1.44125 WP_000719990.1.44130 WP_000719990.1.4415 WP_000719990.1.44162 WP_000719990.1.44165 WP_000719990.1.44201 WP_000719990.1.44203 WP_000719990.1.44211 WP_000719990.1.44222 WP_000719990.1.44238 WP_000719990.1.44251 WP_000719990.1.44263 WP_000719990.1.44264 WP_000719990.1.44285 WP_000719990.1.44287 WP_000719990.1.44292 WP_000719990.1.44324 WP_000719990.1.44327 WP_000719990.1.44354 WP_000719990.1.44365 WP_000719990.1.44389 WP_000719990.1.44394 WP_000719990.1.44422 WP_000719990.1.44445 WP_000719990.1.44447 WP_000719990.1.4445 WP_000719990.1.44452 WP_000719990.1.44460 WP_000719990.1.44461 WP_000719990.1.44488 WP_000719990.1.4449 WP_000719990.1.44524 WP_000719990.1.44561 WP_000719990.1.44570 WP_000719990.1.44587 WP_000719990.1.4459 WP_000719990.1.44608 WP_000719990.1.44610 WP_000719990.1.44627 WP_000719990.1.4463 WP_000719990.1.44642 WP_000719990.1.44649 WP_000719990.1.44661 WP_000719990.1.44668 WP_000719990.1.44671 WP_000719990.1.44717 WP_000719990.1.44724 WP_000719990.1.4473 WP_000719990.1.44733 WP_000719990.1.44756 WP_000719990.1.44759 WP_000719990.1.44784 WP_000719990.1.44821 WP_000719990.1.44836 WP_000719990.1.44840 WP_000719990.1.44841 WP_000719990.1.44843 WP_000719990.1.44849 WP_000719990.1.44854 WP_000719990.1.44855 WP_000719990.1.44857 WP_000719990.1.44906 WP_000719990.1.44923 WP_000719990.1.44954 WP_000719990.1.44960 WP_000719990.1.44961 WP_000719990.1.44970 WP_000719990.1.44975 WP_000719990.1.44977 WP_000719990.1.44980 WP_000719990.1.45000 WP_000719990.1.45020 WP_000719990.1.45025 WP_000719990.1.45028 WP_000719990.1.45043 WP_000719990.1.45053 WP_000719990.1.45076 WP_000719990.1.45104 WP_000719990.1.45116 WP_000719990.1.45153 WP_000719990.1.4516 WP_000719990.1.45190 WP_000719990.1.45195 WP_000719990.1.45208 WP_000719990.1.4524 WP_000719990.1.45246 WP_000719990.1.45293 WP_000719990.1.4530 WP_000719990.1.45301 WP_000719990.1.45313 WP_000719990.1.45329 WP_000719990.1.4535 WP_000719990.1.45359 WP_000719990.1.45392 WP_000719990.1.45404 WP_000719990.1.45405 WP_000719990.1.4541 WP_000719990.1.45440 WP_000719990.1.45444 WP_000719990.1.4549 WP_000719990.1.45525 WP_000719990.1.45536 WP_000719990.1.45538 WP_000719990.1.45565 WP_000719990.1.45575 WP_000719990.1.45581 WP_000719990.1.45595 WP_000719990.1.45600 WP_000719990.1.45627 WP_000719990.1.4563 WP_000719990.1.45664 WP_000719990.1.45676 WP_000719990.1.4570 WP_000719990.1.45707 WP_000719990.1.45718 WP_000719990.1.4574 WP_000719990.1.45741 WP_000719990.1.45752 WP_000719990.1.4576 WP_000719990.1.45789 WP_000719990.1.45793 WP_000719990.1.45799 WP_000719990.1.45801 WP_000719990.1.45806 WP_000719990.1.4583 WP_000719990.1.45840 WP_000719990.1.45841 WP_000719990.1.45846 WP_000719990.1.45865 WP_000719990.1.45868 WP_000719990.1.45891 WP_000719990.1.45901 WP_000719990.1.45921 WP_000719990.1.4593 WP_000719990.1.45930 WP_000719990.1.45931 WP_000719990.1.45933 WP_000719990.1.45941 WP_000719990.1.45945 WP_000719990.1.45949 WP_000719990.1.45960 WP_000719990.1.45968 WP_000719990.1.45990 WP_000719990.1.46016 WP_000719990.1.46026 WP_000719990.1.46027 WP_000719990.1.46039 WP_000719990.1.46048 WP_000719990.1.46049 WP_000719990.1.46081 WP_000719990.1.4610 WP_000719990.1.46105 WP_000719990.1.46115 WP_000719990.1.46122 WP_000719990.1.4613 WP_000719990.1.46164 WP_000719990.1.46186 WP_000719990.1.4619 WP_000719990.1.46197 WP_000719990.1.46217 WP_000719990.1.46239 WP_000719990.1.46257 WP_000719990.1.46263 WP_000719990.1.46282 WP_000719990.1.46283 WP_000719990.1.46291 WP_000719990.1.46301 WP_000719990.1.46325 WP_000719990.1.46329 WP_000719990.1.46369 WP_000719990.1.46378 WP_000719990.1.46379 WP_000719990.1.46414 WP_000719990.1.46429 WP_000719990.1.46433 WP_000719990.1.46438 WP_000719990.1.46441 WP_000719990.1.46451 WP_000719990.1.4646 WP_000719990.1.4647 WP_000719990.1.46487 WP_000719990.1.46526 WP_000719990.1.46552 WP_000719990.1.46555 WP_000719990.1.4657 WP_000719990.1.46573 WP_000719990.1.46582 WP_000719990.1.46589 WP_000719990.1.46594 WP_000719990.1.46597 WP_000719990.1.46602 WP_000719990.1.46611 WP_000719990.1.46616 WP_000719990.1.46626 WP_000719990.1.46668 WP_000719990.1.4670 WP_000719990.1.46743 WP_000719990.1.46795 WP_000719990.1.46798 WP_000719990.1.46802 WP_000719990.1.46806 WP_000719990.1.46810 WP_000719990.1.46820 WP_000719990.1.46821 WP_000719990.1.46832 WP_000719990.1.46833 WP_000719990.1.46841 WP_000719990.1.46860 WP_000719990.1.46876 WP_000719990.1.46882 WP_000719990.1.46898 WP_000719990.1.46909 WP_000719990.1.4691 WP_000719990.1.46912 WP_000719990.1.46913 WP_000719990.1.46932 WP_000719990.1.4695 WP_000719990.1.46990 WP_000719990.1.46991 WP_000719990.1.46994 WP_000719990.1.46999 WP_000719990.1.47024 WP_000719990.1.47028 WP_000719990.1.47029 WP_000719990.1.47030 WP_000719990.1.47034 WP_000719990.1.47038 WP_000719990.1.47039 WP_000719990.1.47047 WP_000719990.1.47048 WP_000719990.1.47050 WP_000719990.1.47054 WP_000719990.1.47063 WP_000719990.1.47069 WP_000719990.1.4708 WP_000719990.1.47124 WP_000719990.1.47140 WP_000719990.1.47156 WP_000719990.1.47167 WP_000719990.1.47171 WP_000719990.1.47189 WP_000719990.1.47197 WP_000719990.1.47198 WP_000719990.1.4722 WP_000719990.1.47224 WP_000719990.1.4723 WP_000719990.1.47235 WP_000719990.1.47246 WP_000719990.1.47247 WP_000719990.1.4725 WP_000719990.1.47280 WP_000719990.1.47307 WP_000719990.1.47316 WP_000719990.1.47319 WP_000719990.1.47322 WP_000719990.1.47344 WP_000719990.1.47349 WP_000719990.1.47356 WP_000719990.1.47363 WP_000719990.1.47366 WP_000719990.1.47370 WP_000719990.1.47386 WP_000719990.1.47398 WP_000719990.1.4740 WP_000719990.1.47401 WP_000719990.1.47411 WP_000719990.1.47414 WP_000719990.1.47425 WP_000719990.1.4743 WP_000719990.1.47454 WP_000719990.1.47464 WP_000719990.1.47473 WP_000719990.1.47477 WP_000719990.1.47488 WP_000719990.1.47496 WP_000719990.1.47498 WP_000719990.1.47500 WP_000719990.1.47529 WP_000719990.1.47533 WP_000719990.1.47546 WP_000719990.1.47555 WP_000719990.1.47582 WP_000719990.1.47599 WP_000719990.1.47634 WP_000719990.1.47646 WP_000719990.1.47654 WP_000719990.1.47662 WP_000719990.1.47673 WP_000719990.1.47709 WP_000719990.1.4772 WP_000719990.1.47722 WP_000719990.1.47734 WP_000719990.1.47740 WP_000719990.1.47744 WP_000719990.1.47764 WP_000719990.1.47765 WP_000719990.1.47775 WP_000719990.1.47784 WP_000719990.1.47790 WP_000719990.1.47791 WP_000719990.1.47820 WP_000719990.1.47827 WP_000719990.1.4783 WP_000719990.1.47848 WP_000719990.1.4785 WP_000719990.1.47884 WP_000719990.1.47935 WP_000719990.1.47954 WP_000719990.1.4796 WP_000719990.1.47962 WP_000719990.1.47976 WP_000719990.1.47983 WP_000719990.1.47994 WP_000719990.1.48000 WP_000719990.1.48018 WP_000719990.1.48029 WP_000719990.1.48040 WP_000719990.1.48048 WP_000719990.1.48051 WP_000719990.1.48065 WP_000719990.1.48077 WP_000719990.1.48080 WP_000719990.1.48090 WP_000719990.1.48096 WP_000719990.1.4811 WP_000719990.1.48111 WP_000719990.1.4812 WP_000719990.1.48121 WP_000719990.1.48144 WP_000719990.1.48168 WP_000719990.1.48176 WP_000719990.1.48188 WP_000719990.1.48194 WP_000719990.1.48203 WP_000719990.1.48216 WP_000719990.1.48222 WP_000719990.1.48226 WP_000719990.1.48258 WP_000719990.1.4826 WP_000719990.1.48265 WP_000719990.1.48285 WP_000719990.1.48290 WP_000719990.1.48291 WP_000719990.1.48317 WP_000719990.1.48353 WP_000719990.1.48355 WP_000719990.1.48371 WP_000719990.1.48385 WP_000719990.1.48421 WP_000719990.1.48431 WP_000719990.1.48433 WP_000719990.1.48469 WP_000719990.1.48477 WP_000719990.1.48480 WP_000719990.1.48483 WP_000719990.1.48505 WP_000719990.1.48522 WP_000719990.1.4857 WP_000719990.1.48571 WP_000719990.1.486 WP_000719990.1.48615 WP_000719990.1.48620 WP_000719990.1.48626 WP_000719990.1.48629 WP_000719990.1.48678 WP_000719990.1.48697 WP_000719990.1.4871 WP_000719990.1.48712 WP_000719990.1.4876 WP_000719990.1.48771 WP_000719990.1.48792 WP_000719990.1.48801 WP_000719990.1.48806 WP_000719990.1.48808 WP_000719990.1.48827 WP_000719990.1.48847 WP_000719990.1.48860 WP_000719990.1.48901 WP_000719990.1.48902 WP_000719990.1.48907 WP_000719990.1.48910 WP_000719990.1.4892 WP_000719990.1.48921 WP_000719990.1.48926 WP_000719990.1.48928 WP_000719990.1.48953 WP_000719990.1.48954 WP_000719990.1.48970 WP_000719990.1.48974 WP_000719990.1.49001 WP_000719990.1.49009 WP_000719990.1.49061 WP_000719990.1.49104 WP_000719990.1.49107 WP_000719990.1.49124 WP_000719990.1.49136 WP_000719990.1.49170 WP_000719990.1.49179 WP_000719990.1.49190 WP_000719990.1.49229 WP_000719990.1.49236 WP_000719990.1.49243 WP_000719990.1.49258 WP_000719990.1.49275 WP_000719990.1.4931 WP_000719990.1.49312 WP_000719990.1.49321 WP_000719990.1.49332 WP_000719990.1.49336 WP_000719990.1.49338 WP_000719990.1.49342 WP_000719990.1.49347 WP_000719990.1.49401 WP_000719990.1.49412 WP_000719990.1.49446 WP_000719990.1.49459 WP_000719990.1.49464 WP_000719990.1.49481 WP_000719990.1.49482 WP_000719990.1.49483 WP_000719990.1.4949 WP_000719990.1.49496 WP_000719990.1.49521 WP_000719990.1.49522 WP_000719990.1.4953 WP_000719990.1.49531 WP_000719990.1.49537 WP_000719990.1.49546 WP_000719990.1.49558 WP_000719990.1.49567 WP_000719990.1.49594 WP_000719990.1.49599 WP_000719990.1.49615 WP_000719990.1.49621 WP_000719990.1.49625 WP_000719990.1.49645 WP_000719990.1.49655 WP_000719990.1.49661 WP_000719990.1.49662 WP_000719990.1.49675 WP_000719990.1.49684 WP_000719990.1.497 WP_000719990.1.49712 WP_000719990.1.49722 WP_000719990.1.49733 WP_000719990.1.49740 WP_000719990.1.49747 WP_000719990.1.49768 WP_000719990.1.49771 WP_000719990.1.49774 WP_000719990.1.49783 WP_000719990.1.49788 WP_000719990.1.49794 WP_000719990.1.49820 WP_000719990.1.49823 WP_000719990.1.4985 WP_000719990.1.49856 WP_000719990.1.49861 WP_000719990.1.49879 WP_000719990.1.49883 WP_000719990.1.49884 WP_000719990.1.49900 WP_000719990.1.49902 WP_000719990.1.49941 WP_000719990.1.49950 WP_000719990.1.49954 WP_000719990.1.49972 WP_000719990.1.49987 WP_000719990.1.50006 WP_000719990.1.5003 WP_000719990.1.50036 WP_000719990.1.50056 WP_000719990.1.50058 WP_000719990.1.50078 WP_000719990.1.50098 WP_000719990.1.50110 WP_000719990.1.50113 WP_000719990.1.50119 WP_000719990.1.50146 WP_000719990.1.5017 WP_000719990.1.50179 WP_000719990.1.50182 WP_000719990.1.50187 WP_000719990.1.50191 WP_000719990.1.50196 WP_000719990.1.50207 WP_000719990.1.50228 WP_000719990.1.50230 WP_000719990.1.50258 WP_000719990.1.50262 WP_000719990.1.50266 WP_000719990.1.50269 WP_000719990.1.50270 WP_000719990.1.50278 WP_000719990.1.50345 WP_000719990.1.50353 WP_000719990.1.50358 WP_000719990.1.50361 WP_000719990.1.50366 WP_000719990.1.5037 WP_000719990.1.50380 WP_000719990.1.5040 WP_000719990.1.50412 WP_000719990.1.50418 WP_000719990.1.50427 WP_000719990.1.50452 WP_000719990.1.5046 WP_000719990.1.50548 WP_000719990.1.50549 WP_000719990.1.5056 WP_000719990.1.50564 WP_000719990.1.50579 WP_000719990.1.50585 WP_000719990.1.50586 WP_000719990.1.50608 WP_000719990.1.50616 WP_000719990.1.50627 WP_000719990.1.5067 WP_000719990.1.50690 WP_000719990.1.50700 WP_000719990.1.50715 WP_000719990.1.50717 WP_000719990.1.50725 WP_000719990.1.50728 WP_000719990.1.50762 WP_000719990.1.50887 WP_000719990.1.50936 WP_000719990.1.50939 WP_000719990.1.50947 WP_000719990.1.5095 WP_000719990.1.50957 WP_000719990.1.50969 WP_000719990.1.50986 WP_000719990.1.50988 WP_000719990.1.50990 WP_000719990.1.50996 WP_000719990.1.51013 WP_000719990.1.51042 WP_000719990.1.51058 WP_000719990.1.5106 WP_000719990.1.511 WP_000719990.1.51109 WP_000719990.1.51154 WP_000719990.1.51170 WP_000719990.1.51171 WP_000719990.1.51172 WP_000719990.1.51175 WP_000719990.1.51180 WP_000719990.1.51190 WP_000719990.1.51201 WP_000719990.1.51203 WP_000719990.1.51206 WP_000719990.1.51211 WP_000719990.1.5124 WP_000719990.1.51248 WP_000719990.1.51253 WP_000719990.1.51255 WP_000719990.1.51260 WP_000719990.1.51278 WP_000719990.1.5128 WP_000719990.1.51283 WP_000719990.1.51299 WP_000719990.1.51300 WP_000719990.1.51307 WP_000719990.1.51323 WP_000719990.1.51325 WP_000719990.1.51330 WP_000719990.1.51336 WP_000719990.1.51380 WP_000719990.1.51392 WP_000719990.1.51405 WP_000719990.1.51425 WP_000719990.1.51426 WP_000719990.1.51427 WP_000719990.1.51441 WP_000719990.1.5146 WP_000719990.1.51462 WP_000719990.1.51490 WP_000719990.1.51495 WP_000719990.1.51505 WP_000719990.1.5153 WP_000719990.1.51537 WP_000719990.1.51539 WP_000719990.1.51548 WP_000719990.1.51552 WP_000719990.1.5157 WP_000719990.1.5158 WP_000719990.1.51580 WP_000719990.1.51587 WP_000719990.1.51596 WP_000719990.1.51600 WP_000719990.1.51607 WP_000719990.1.51629 WP_000719990.1.51643 WP_000719990.1.51690 WP_000719990.1.51693 WP_000719990.1.51707 WP_000719990.1.51718 WP_000719990.1.5172 WP_000719990.1.51736 WP_000719990.1.51757 WP_000719990.1.51760 WP_000719990.1.51784 WP_000719990.1.518 WP_000719990.1.51804 WP_000719990.1.51834 WP_000719990.1.51837 WP_000719990.1.51839 WP_000719990.1.51873 WP_000719990.1.51881 WP_000719990.1.51896 WP_000719990.1.51899 WP_000719990.1.51944 WP_000719990.1.51949 WP_000719990.1.51968 WP_000719990.1.51985 WP_000719990.1.51988 WP_000719990.1.5199 WP_000719990.1.51999 WP_000719990.1.52020 WP_000719990.1.52039 WP_000719990.1.52048 WP_000719990.1.52076 WP_000719990.1.52085 WP_000719990.1.52098 WP_000719990.1.52126 WP_000719990.1.52127 WP_000719990.1.52137 WP_000719990.1.5217 WP_000719990.1.52171 WP_000719990.1.52186 WP_000719990.1.52200 WP_000719990.1.52211 WP_000719990.1.52214 WP_000719990.1.52230 WP_000719990.1.52243 WP_000719990.1.52249 WP_000719990.1.52258 WP_000719990.1.52270 WP_000719990.1.52271 WP_000719990.1.52272 WP_000719990.1.52299 WP_000719990.1.52305 WP_000719990.1.52313 WP_000719990.1.52333 WP_000719990.1.52363 WP_000719990.1.52378 WP_000719990.1.5239 WP_000719990.1.52399 WP_000719990.1.52406 WP_000719990.1.52419 WP_000719990.1.52421 WP_000719990.1.52496 WP_000719990.1.52524 WP_000719990.1.52542 WP_000719990.1.52543 WP_000719990.1.52544 WP_000719990.1.52558 WP_000719990.1.52568 WP_000719990.1.52601 WP_000719990.1.52612 WP_000719990.1.52631 WP_000719990.1.5265 WP_000719990.1.52662 WP_000719990.1.52691 WP_000719990.1.52704 WP_000719990.1.52710 WP_000719990.1.5272 WP_000719990.1.52735 WP_000719990.1.52762 WP_000719990.1.52771 WP_000719990.1.52774 WP_000719990.1.52777 WP_000719990.1.52780 WP_000719990.1.52781 WP_000719990.1.52801 WP_000719990.1.52844 WP_000719990.1.52846 WP_000719990.1.5285 WP_000719990.1.52852 WP_000719990.1.52853 WP_000719990.1.52855 WP_000719990.1.52881 WP_000719990.1.52883 WP_000719990.1.52895 WP_000719990.1.52908 WP_000719990.1.5291 WP_000719990.1.52933 WP_000719990.1.52945 WP_000719990.1.52962 WP_000719990.1.52995 WP_000719990.1.53012 WP_000719990.1.53020 WP_000719990.1.53021 WP_000719990.1.53027 WP_000719990.1.53065 WP_000719990.1.53084 WP_000719990.1.53095 WP_000719990.1.5310 WP_000719990.1.53110 WP_000719990.1.53123 WP_000719990.1.53155 WP_000719990.1.53162 WP_000719990.1.53181 WP_000719990.1.532 WP_000719990.1.53211 WP_000719990.1.5322 WP_000719990.1.53223 WP_000719990.1.53238 WP_000719990.1.53244 WP_000719990.1.53251 WP_000719990.1.53262 WP_000719990.1.53270 WP_000719990.1.53327 WP_000719990.1.53356 WP_000719990.1.53360 WP_000719990.1.53364 WP_000719990.1.53377 WP_000719990.1.53401 WP_000719990.1.53410 WP_000719990.1.53415 WP_000719990.1.5342 WP_000719990.1.53428 WP_000719990.1.53431 WP_000719990.1.53482 WP_000719990.1.53505 WP_000719990.1.53537 WP_000719990.1.53545 WP_000719990.1.53556 WP_000719990.1.53557 WP_000719990.1.53587 WP_000719990.1.53590 WP_000719990.1.53592 WP_000719990.1.53594 WP_000719990.1.5362 WP_000719990.1.53642 WP_000719990.1.53645 WP_000719990.1.53649 WP_000719990.1.53687 WP_000719990.1.53690 WP_000719990.1.53693 WP_000719990.1.53706 WP_000719990.1.53769 WP_000719990.1.53809 WP_000719990.1.53811 WP_000719990.1.53841 WP_000719990.1.53863 WP_000719990.1.53866 WP_000719990.1.53878 WP_000719990.1.5391 WP_000719990.1.53931 WP_000719990.1.53940 WP_000719990.1.53966 WP_000719990.1.53972 WP_000719990.1.53978 WP_000719990.1.53991 WP_000719990.1.53994 WP_000719990.1.54002 WP_000719990.1.54013 WP_000719990.1.54023 WP_000719990.1.54024 WP_000719990.1.54032 WP_000719990.1.54051 WP_000719990.1.54072 WP_000719990.1.54091 WP_000719990.1.54095 WP_000719990.1.54102 WP_000719990.1.54104 WP_000719990.1.54169 WP_000719990.1.54185 WP_000719990.1.54188 WP_000719990.1.54208 WP_000719990.1.54213 WP_000719990.1.54263 WP_000719990.1.54307 WP_000719990.1.54313 WP_000719990.1.54317 WP_000719990.1.54328 WP_000719990.1.54329 WP_000719990.1.5433 WP_000719990.1.5434 WP_000719990.1.54344 WP_000719990.1.54359 WP_000719990.1.54388 WP_000719990.1.54394 WP_000719990.1.5441 WP_000719990.1.54411 WP_000719990.1.54418 WP_000719990.1.54429 WP_000719990.1.54439 WP_000719990.1.54454 WP_000719990.1.54463 WP_000719990.1.54476 WP_000719990.1.54507 WP_000719990.1.54524 WP_000719990.1.54534 WP_000719990.1.54546 WP_000719990.1.54590 WP_000719990.1.54591 WP_000719990.1.5460 WP_000719990.1.54602 WP_000719990.1.54605 WP_000719990.1.5461 WP_000719990.1.54617 WP_000719990.1.54620 WP_000719990.1.54625 WP_000719990.1.54638 WP_000719990.1.5467 WP_000719990.1.54688 WP_000719990.1.54695 WP_000719990.1.5470 WP_000719990.1.54708 WP_000719990.1.54725 WP_000719990.1.54729 WP_000719990.1.54754 WP_000719990.1.54755 WP_000719990.1.54769 WP_000719990.1.5478 WP_000719990.1.5479 WP_000719990.1.54817 WP_000719990.1.54829 WP_000719990.1.5486 WP_000719990.1.54875 WP_000719990.1.54883 WP_000719990.1.54918 WP_000719990.1.54927 WP_000719990.1.54940 WP_000719990.1.54972 WP_000719990.1.54981 WP_000719990.1.54989 WP_000719990.1.54991 WP_000719990.1.54993 WP_000719990.1.55003 WP_000719990.1.55005 WP_000719990.1.55009 WP_000719990.1.55041 WP_000719990.1.55070 WP_000719990.1.55112 WP_000719990.1.55115 WP_000719990.1.55123 WP_000719990.1.55134 WP_000719990.1.55144 WP_000719990.1.55149 WP_000719990.1.55151 WP_000719990.1.55177 WP_000719990.1.55179 WP_000719990.1.55185 WP_000719990.1.55197 WP_000719990.1.5520 WP_000719990.1.55203 WP_000719990.1.55218 WP_000719990.1.55222 WP_000719990.1.55226 WP_000719990.1.55273 WP_000719990.1.55275 WP_000719990.1.55286 WP_000719990.1.55291 WP_000719990.1.55338 WP_000719990.1.55342 WP_000719990.1.55357 WP_000719990.1.55359 WP_000719990.1.55374 WP_000719990.1.55381 WP_000719990.1.55417 WP_000719990.1.55420 WP_000719990.1.55424 WP_000719990.1.55425 WP_000719990.1.5546 WP_000719990.1.55466 WP_000719990.1.55472 WP_000719990.1.55492 WP_000719990.1.55507 WP_000719990.1.55529 WP_000719990.1.55550 WP_000719990.1.55551 WP_000719990.1.55552 WP_000719990.1.55556 WP_000719990.1.55560 WP_000719990.1.55563 WP_000719990.1.55571 WP_000719990.1.55581 WP_000719990.1.55597 WP_000719990.1.55608 WP_000719990.1.5561 WP_000719990.1.55629 WP_000719990.1.55676 WP_000719990.1.5570 WP_000719990.1.55709 WP_000719990.1.55720 WP_000719990.1.55730 WP_000719990.1.55731 WP_000719990.1.55757 WP_000719990.1.55787 WP_000719990.1.55790 WP_000719990.1.55791 WP_000719990.1.55808 WP_000719990.1.55820 WP_000719990.1.55825 WP_000719990.1.55838 WP_000719990.1.55844 WP_000719990.1.55868 WP_000719990.1.55870 WP_000719990.1.55888 WP_000719990.1.55892 WP_000719990.1.55896 WP_000719990.1.55897 WP_000719990.1.55936 WP_000719990.1.55981 WP_000719990.1.55988 WP_000719990.1.55990 WP_000719990.1.56033 WP_000719990.1.56040 WP_000719990.1.56047 WP_000719990.1.56072 WP_000719990.1.561 WP_000719990.1.56122 WP_000719990.1.56139 WP_000719990.1.5614 WP_000719990.1.56142 WP_000719990.1.56149 WP_000719990.1.56151 WP_000719990.1.5616 WP_000719990.1.56164 WP_000719990.1.56169 WP_000719990.1.56177 WP_000719990.1.56193 WP_000719990.1.562 WP_000719990.1.56216 WP_000719990.1.56231 WP_000719990.1.56278 WP_000719990.1.56285 WP_000719990.1.56293 WP_000719990.1.5632 WP_000719990.1.56338 WP_000719990.1.56358 WP_000719990.1.56371 WP_000719990.1.5639 WP_000719990.1.56390 WP_000719990.1.56392 WP_000719990.1.56399 WP_000719990.1.56402 WP_000719990.1.56436 WP_000719990.1.56439 WP_000719990.1.56446 WP_000719990.1.56457 WP_000719990.1.5646 WP_000719990.1.56469 WP_000719990.1.56481 WP_000719990.1.56489 WP_000719990.1.56491 WP_000719990.1.56501 WP_000719990.1.56502 WP_000719990.1.56513 WP_000719990.1.56523 WP_000719990.1.56543 WP_000719990.1.56554 WP_000719990.1.56571 WP_000719990.1.56573 WP_000719990.1.56586 WP_000719990.1.56650 WP_000719990.1.56662 WP_000719990.1.56665 WP_000719990.1.56680 WP_000719990.1.56689 WP_000719990.1.5670 WP_000719990.1.56704 WP_000719990.1.56713 WP_000719990.1.56714 WP_000719990.1.56721 WP_000719990.1.56742 WP_000719990.1.56776 WP_000719990.1.56786 WP_000719990.1.56787 WP_000719990.1.56789 WP_000719990.1.56799 WP_000719990.1.56821 WP_000719990.1.56830 WP_000719990.1.56835 WP_000719990.1.56846 WP_000719990.1.56871 WP_000719990.1.56932 WP_000719990.1.56933 WP_000719990.1.56934 WP_000719990.1.56936 WP_000719990.1.56937 WP_000719990.1.56941 WP_000719990.1.56978 WP_000719990.1.56980 WP_000719990.1.57011 WP_000719990.1.57032 WP_000719990.1.57045 WP_000719990.1.57051 WP_000719990.1.57068 WP_000719990.1.57071 WP_000719990.1.57072 WP_000719990.1.57079 WP_000719990.1.57086 WP_000719990.1.57100 WP_000719990.1.57124 WP_000719990.1.57150 WP_000719990.1.57159 WP_000719990.1.57180 WP_000719990.1.57181 WP_000719990.1.57185 WP_000719990.1.57197 WP_000719990.1.57202 WP_000719990.1.57213 WP_000719990.1.57216 WP_000719990.1.57254 WP_000719990.1.57266 WP_000719990.1.57278 WP_000719990.1.57280 WP_000719990.1.57281 WP_000719990.1.57348 WP_000719990.1.57349 WP_000719990.1.57386 WP_000719990.1.57395 WP_000719990.1.57401 WP_000719990.1.57403 WP_000719990.1.57414 WP_000719990.1.5742 WP_000719990.1.57432 WP_000719990.1.57438 WP_000719990.1.57451 WP_000719990.1.57453 WP_000719990.1.57466 WP_000719990.1.5748 WP_000719990.1.57487 WP_000719990.1.57492 WP_000719990.1.57517 WP_000719990.1.57538 WP_000719990.1.57539 WP_000719990.1.5755 WP_000719990.1.57550 WP_000719990.1.57558 WP_000719990.1.57588 WP_000719990.1.57608 WP_000719990.1.57610 WP_000719990.1.57629 WP_000719990.1.57638 WP_000719990.1.5764 WP_000719990.1.57646 WP_000719990.1.57659 WP_000719990.1.57663 WP_000719990.1.57669 WP_000719990.1.57719 WP_000719990.1.57738 WP_000719990.1.57812 WP_000719990.1.57832 WP_000719990.1.57836 WP_000719990.1.57846 WP_000719990.1.57851 WP_000719990.1.57854 WP_000719990.1.5786 WP_000719990.1.5787 WP_000719990.1.57898 WP_000719990.1.57904 WP_000719990.1.57920 WP_000719990.1.57982 WP_000719990.1.57994 WP_000719990.1.58001 WP_000719990.1.58009 WP_000719990.1.58022 WP_000719990.1.58045 WP_000719990.1.58048 WP_000719990.1.58057 WP_000719990.1.58060 WP_000719990.1.58080 WP_000719990.1.58094 WP_000719990.1.58097 WP_000719990.1.5810 WP_000719990.1.58107 WP_000719990.1.58128 WP_000719990.1.58136 WP_000719990.1.58143 WP_000719990.1.58146 WP_000719990.1.58163 WP_000719990.1.58169 WP_000719990.1.58172 WP_000719990.1.58206 WP_000719990.1.58226 WP_000719990.1.58232 WP_000719990.1.58233 WP_000719990.1.58238 WP_000719990.1.58244 WP_000719990.1.58248 WP_000719990.1.58267 WP_000719990.1.58289 WP_000719990.1.58292 WP_000719990.1.58316 WP_000719990.1.58336 WP_000719990.1.58340 WP_000719990.1.58345 WP_000719990.1.58371 WP_000719990.1.58384 WP_000719990.1.58401 WP_000719990.1.58408 WP_000719990.1.58414 WP_000719990.1.5842 WP_000719990.1.58420 WP_000719990.1.58423 WP_000719990.1.58424 WP_000719990.1.58429 WP_000719990.1.58444 WP_000719990.1.58445 WP_000719990.1.58449 WP_000719990.1.58459 WP_000719990.1.58475 WP_000719990.1.58493 WP_000719990.1.585 WP_000719990.1.58507 WP_000719990.1.58514 WP_000719990.1.5852 WP_000719990.1.58528 WP_000719990.1.58552 WP_000719990.1.58572 WP_000719990.1.58582 WP_000719990.1.58609 WP_000719990.1.58617 WP_000719990.1.58622 WP_000719990.1.58657 WP_000719990.1.58692 WP_000719990.1.58705 WP_000719990.1.58707 WP_000719990.1.58723 WP_000719990.1.58737 WP_000719990.1.58837 WP_000719990.1.58867 WP_000719990.1.58870 WP_000719990.1.58901 WP_000719990.1.58940 WP_000719990.1.58942 WP_000719990.1.58951 WP_000719990.1.58958 WP_000719990.1.58976 WP_000719990.1.58977 WP_000719990.1.58983 WP_000719990.1.59024 WP_000719990.1.59026 WP_000719990.1.59035 WP_000719990.1.59038 WP_000719990.1.59047 WP_000719990.1.59055 WP_000719990.1.5906 WP_000719990.1.59060 WP_000719990.1.59073 WP_000719990.1.59083 WP_000719990.1.59119 WP_000719990.1.59165 WP_000719990.1.59174 WP_000719990.1.59190 WP_000719990.1.59199 WP_000719990.1.59226 WP_000719990.1.59263 WP_000719990.1.5927 WP_000719990.1.59280 WP_000719990.1.59291 WP_000719990.1.59292 WP_000719990.1.59293 WP_000719990.1.59302 WP_000719990.1.59306 WP_000719990.1.59359 WP_000719990.1.59374 WP_000719990.1.59395 WP_000719990.1.59396 WP_000719990.1.59407 WP_000719990.1.59409 WP_000719990.1.59413 WP_000719990.1.5942 WP_000719990.1.59423 WP_000719990.1.59425 WP_000719990.1.59426 WP_000719990.1.59434 WP_000719990.1.59470 WP_000719990.1.59483 WP_000719990.1.59491 WP_000719990.1.59513 WP_000719990.1.59533 WP_000719990.1.59572 WP_000719990.1.59577 WP_000719990.1.59579 WP_000719990.1.59590 WP_000719990.1.59611 WP_000719990.1.59613 WP_000719990.1.59615 WP_000719990.1.59621 WP_000719990.1.5963 WP_000719990.1.59638 WP_000719990.1.5965 WP_000719990.1.59660 WP_000719990.1.59679 WP_000719990.1.59699 WP_000719990.1.59714 WP_000719990.1.59717 WP_000719990.1.59730 WP_000719990.1.59733 WP_000719990.1.59737 WP_000719990.1.59745 WP_000719990.1.59756 WP_000719990.1.59781 WP_000719990.1.59782 WP_000719990.1.59788 WP_000719990.1.59791 WP_000719990.1.59815 WP_000719990.1.59823 WP_000719990.1.59836 WP_000719990.1.59838 WP_000719990.1.59853 WP_000719990.1.59858 WP_000719990.1.59877 WP_000719990.1.59894 WP_000719990.1.59900 WP_000719990.1.59905 WP_000719990.1.59912 WP_000719990.1.59931 WP_000719990.1.59932 WP_000719990.1.59959 WP_000719990.1.59970 WP_000719990.1.59980 WP_000719990.1.59981 WP_000719990.1.59989 WP_000719990.1.59998 WP_000719990.1.6002 WP_000719990.1.60023 WP_000719990.1.60031 WP_000719990.1.60042 WP_000719990.1.60043 WP_000719990.1.60048 WP_000719990.1.60067 WP_000719990.1.60070 WP_000719990.1.60095 WP_000719990.1.60096 WP_000719990.1.60110 WP_000719990.1.60117 WP_000719990.1.6013 WP_000719990.1.60133 WP_000719990.1.60151 WP_000719990.1.6022 WP_000719990.1.60225 WP_000719990.1.60228 WP_000719990.1.60235 WP_000719990.1.60304 WP_000719990.1.60325 WP_000719990.1.60337 WP_000719990.1.60342 WP_000719990.1.60343 WP_000719990.1.60350 WP_000719990.1.60373 WP_000719990.1.60374 WP_000719990.1.60387 WP_000719990.1.60411 WP_000719990.1.60436 WP_000719990.1.60453 WP_000719990.1.60457 WP_000719990.1.60461 WP_000719990.1.60477 WP_000719990.1.60491 WP_000719990.1.60498 WP_000719990.1.60505 WP_000719990.1.60544 WP_000719990.1.60550 WP_000719990.1.60555 WP_000719990.1.60567 WP_000719990.1.60576 WP_000719990.1.6059 WP_000719990.1.60591 WP_000719990.1.60606 WP_000719990.1.6061 WP_000719990.1.60613 WP_000719990.1.60630 WP_000719990.1.6064 WP_000719990.1.60647 WP_000719990.1.60654 WP_000719990.1.6066 WP_000719990.1.6068 WP_000719990.1.60698 WP_000719990.1.60717 WP_000719990.1.60732 WP_000719990.1.60744 WP_000719990.1.60761 WP_000719990.1.60764 WP_000719990.1.60832 WP_000719990.1.60835 WP_000719990.1.60872 WP_000719990.1.60895 WP_000719990.1.60901 WP_000719990.1.60925 WP_000719990.1.60927 WP_000719990.1.60935 WP_000719990.1.6094 WP_000719990.1.60974 WP_000719990.1.61005 WP_000719990.1.61006 WP_000719990.1.61008 WP_000719990.1.61039 WP_000719990.1.61046 WP_000719990.1.61058 WP_000719990.1.6106 WP_000719990.1.61097 WP_000719990.1.61099 WP_000719990.1.6110 WP_000719990.1.61102 WP_000719990.1.61108 WP_000719990.1.61112 WP_000719990.1.61121 WP_000719990.1.61132 WP_000719990.1.61170 WP_000719990.1.61174 WP_000719990.1.61175 WP_000719990.1.61181 WP_000719990.1.61183 WP_000719990.1.61186 WP_000719990.1.61225 WP_000719990.1.61241 WP_000719990.1.61245 WP_000719990.1.61253 WP_000719990.1.61284 WP_000719990.1.61292 WP_000719990.1.613 WP_000719990.1.61360 WP_000719990.1.6138 WP_000719990.1.61398 WP_000719990.1.61442 WP_000719990.1.61445 WP_000719990.1.61480 WP_000719990.1.615 WP_000719990.1.61505 WP_000719990.1.61512 WP_000719990.1.61517 WP_000719990.1.61524 WP_000719990.1.61551 WP_000719990.1.61617 WP_000719990.1.61623 WP_000719990.1.61636 WP_000719990.1.61663 WP_000719990.1.61739 WP_000719990.1.61758 WP_000719990.1.61770 WP_000719990.1.61772 WP_000719990.1.61779 WP_000719990.1.61789 WP_000719990.1.618 WP_000719990.1.61806 WP_000719990.1.61822 WP_000719990.1.61835 WP_000719990.1.61853 WP_000719990.1.61858 WP_000719990.1.61874 WP_000719990.1.61926 WP_000719990.1.61939 WP_000719990.1.61948 WP_000719990.1.61949 WP_000719990.1.61955 WP_000719990.1.61957 WP_000719990.1.62038 WP_000719990.1.62041 WP_000719990.1.62043 WP_000719990.1.62091 WP_000719990.1.62099 WP_000719990.1.62102 WP_000719990.1.6212 WP_000719990.1.62135 WP_000719990.1.62157 WP_000719990.1.62182 WP_000719990.1.62207 WP_000719990.1.62236 WP_000719990.1.62262 WP_000719990.1.62264 WP_000719990.1.62266 WP_000719990.1.62273 WP_000719990.1.62282 WP_000719990.1.62290 WP_000719990.1.62296 WP_000719990.1.62337 WP_000719990.1.62358 WP_000719990.1.62424 WP_000719990.1.62447 WP_000719990.1.62454 WP_000719990.1.62460 WP_000719990.1.62480 WP_000719990.1.62481 WP_000719990.1.62487 WP_000719990.1.62514 WP_000719990.1.62529 WP_000719990.1.62541 WP_000719990.1.62555 WP_000719990.1.62586 WP_000719990.1.6261 WP_000719990.1.62612 WP_000719990.1.62631 WP_000719990.1.62642 WP_000719990.1.62668 WP_000719990.1.62675 WP_000719990.1.62681 WP_000719990.1.62714 WP_000719990.1.62735 WP_000719990.1.62750 WP_000719990.1.62762 WP_000719990.1.62780 WP_000719990.1.62784 WP_000719990.1.62787 WP_000719990.1.62788 WP_000719990.1.62812 WP_000719990.1.62818 WP_000719990.1.62819 WP_000719990.1.6282 WP_000719990.1.62840 WP_000719990.1.62843 WP_000719990.1.62850 WP_000719990.1.62851 WP_000719990.1.62866 WP_000719990.1.62885 WP_000719990.1.62888 WP_000719990.1.62914 WP_000719990.1.62919 WP_000719990.1.6293 WP_000719990.1.62931 WP_000719990.1.62951 WP_000719990.1.62959 WP_000719990.1.62973 WP_000719990.1.62989 WP_000719990.1.6299 WP_000719990.1.63078 WP_000719990.1.63113 WP_000719990.1.63167 WP_000719990.1.63177 WP_000719990.1.63189 WP_000719990.1.63246 WP_000719990.1.63271 WP_000719990.1.63285 WP_000719990.1.63305 WP_000719990.1.6331 WP_000719990.1.63310 WP_000719990.1.63330 WP_000719990.1.6334 WP_000719990.1.63350 WP_000719990.1.6337 WP_000719990.1.63370 WP_000719990.1.63374 WP_000719990.1.63393 WP_000719990.1.63419 WP_000719990.1.63433 WP_000719990.1.63437 WP_000719990.1.63445 WP_000719990.1.63453 WP_000719990.1.63465 WP_000719990.1.63466 WP_000719990.1.63467 WP_000719990.1.63470 WP_000719990.1.63478 WP_000719990.1.6348 WP_000719990.1.63484 WP_000719990.1.63487 WP_000719990.1.63491 WP_000719990.1.63496 WP_000719990.1.63536 WP_000719990.1.63554 WP_000719990.1.63556 WP_000719990.1.63563 WP_000719990.1.63576 WP_000719990.1.63586 WP_000719990.1.63612 WP_000719990.1.63615 WP_000719990.1.6364 WP_000719990.1.63666 WP_000719990.1.63679 WP_000719990.1.63683 WP_000719990.1.63703 WP_000719990.1.63721 WP_000719990.1.63746 WP_000719990.1.63814 WP_000719990.1.63821 WP_000719990.1.63856 WP_000719990.1.63872 WP_000719990.1.63944 WP_000719990.1.63957 WP_000719990.1.63990 WP_000719990.1.64008 WP_000719990.1.64014 WP_000719990.1.64030 WP_000719990.1.64040 WP_000719990.1.64045 WP_000719990.1.64050 WP_000719990.1.64053 WP_000719990.1.64074 WP_000719990.1.64080 WP_000719990.1.64086 WP_000719990.1.64110 WP_000719990.1.64138 WP_000719990.1.64150 WP_000719990.1.64153 WP_000719990.1.6416 WP_000719990.1.64161 WP_000719990.1.64165 WP_000719990.1.64175 WP_000719990.1.64180 WP_000719990.1.64190 WP_000719990.1.64193 WP_000719990.1.64285 WP_000719990.1.64286 WP_000719990.1.643 WP_000719990.1.6431 WP_000719990.1.64312 WP_000719990.1.64321 WP_000719990.1.64330 WP_000719990.1.64355 WP_000719990.1.64356 WP_000719990.1.64371 WP_000719990.1.64380 WP_000719990.1.64391 WP_000719990.1.6441 WP_000719990.1.64417 WP_000719990.1.64438 WP_000719990.1.6444 WP_000719990.1.64448 WP_000719990.1.6445 WP_000719990.1.64458 WP_000719990.1.6446 WP_000719990.1.64519 WP_000719990.1.64520 WP_000719990.1.64528 WP_000719990.1.64547 WP_000719990.1.64563 WP_000719990.1.64621 WP_000719990.1.64657 WP_000719990.1.64670 WP_000719990.1.64693 WP_000719990.1.64695 WP_000719990.1.64707 WP_000719990.1.64712 WP_000719990.1.64746 WP_000719990.1.64749 WP_000719990.1.64784 WP_000719990.1.64789 WP_000719990.1.64793 WP_000719990.1.64840 WP_000719990.1.64875 WP_000719990.1.64881 WP_000719990.1.64912 WP_000719990.1.64926 WP_000719990.1.64930 WP_000719990.1.64939 WP_000719990.1.64946 WP_000719990.1.64970 WP_000719990.1.6499 WP_000719990.1.64990 WP_000719990.1.6500 WP_000719990.1.65023 WP_000719990.1.65035 WP_000719990.1.65056 WP_000719990.1.65061 WP_000719990.1.65084 WP_000719990.1.65097 WP_000719990.1.65104 WP_000719990.1.6511 WP_000719990.1.65110 WP_000719990.1.65114 WP_000719990.1.65116 WP_000719990.1.65118 WP_000719990.1.65122 WP_000719990.1.65151 WP_000719990.1.65155 WP_000719990.1.65179 WP_000719990.1.65194 WP_000719990.1.65240 WP_000719990.1.65256 WP_000719990.1.6527 WP_000719990.1.65271 WP_000719990.1.65286 WP_000719990.1.65296 WP_000719990.1.65305 WP_000719990.1.65306 WP_000719990.1.65353 WP_000719990.1.65355 WP_000719990.1.65364 WP_000719990.1.65366 WP_000719990.1.65370 WP_000719990.1.65372 WP_000719990.1.654 WP_000719990.1.65405 WP_000719990.1.65408 WP_000719990.1.65413 WP_000719990.1.65415 WP_000719990.1.65456 WP_000719990.1.65484 WP_000719990.1.65493 WP_000719990.1.65531 WP_000719990.1.65565 WP_000719990.1.65571 WP_000719990.1.65581 WP_000719990.1.65596 WP_000719990.1.65606 WP_000719990.1.6563 WP_000719990.1.65672 WP_000719990.1.65708 WP_000719990.1.65749 WP_000719990.1.6576 WP_000719990.1.65762 WP_000719990.1.65834 WP_000719990.1.6587 WP_000719990.1.65875 WP_000719990.1.65898 WP_000719990.1.65912 WP_000719990.1.65954 WP_000719990.1.65957 WP_000719990.1.65961 WP_000719990.1.65962 WP_000719990.1.65963 WP_000719990.1.65978 WP_000719990.1.65988 WP_000719990.1.66001 WP_000719990.1.66007 WP_000719990.1.66016 WP_000719990.1.66017 WP_000719990.1.66022 WP_000719990.1.66033 WP_000719990.1.6604 WP_000719990.1.66044 WP_000719990.1.66050 WP_000719990.1.66059 WP_000719990.1.66071 WP_000719990.1.6609 WP_000719990.1.66094 WP_000719990.1.66100 WP_000719990.1.66104 WP_000719990.1.66121 WP_000719990.1.66127 WP_000719990.1.66161 WP_000719990.1.6618 WP_000719990.1.66181 WP_000719990.1.66187 WP_000719990.1.66197 WP_000719990.1.66251 WP_000719990.1.66255 WP_000719990.1.66280 WP_000719990.1.66288 WP_000719990.1.66290 WP_000719990.1.66295 WP_000719990.1.66327 WP_000719990.1.6635 WP_000719990.1.66376 WP_000719990.1.66387 WP_000719990.1.66389 WP_000719990.1.66392 WP_000719990.1.66395 WP_000719990.1.66412 WP_000719990.1.66421 WP_000719990.1.66448 WP_000719990.1.6645 WP_000719990.1.66501 WP_000719990.1.66511 WP_000719990.1.66523 WP_000719990.1.66531 WP_000719990.1.6654 WP_000719990.1.66550 WP_000719990.1.66559 WP_000719990.1.66566 WP_000719990.1.66579 WP_000719990.1.66644 WP_000719990.1.6665 WP_000719990.1.6666 WP_000719990.1.66667 WP_000719990.1.66668 WP_000719990.1.66700 WP_000719990.1.66706 WP_000719990.1.66708 WP_000719990.1.66727 WP_000719990.1.66751 WP_000719990.1.66758 WP_000719990.1.6676 WP_000719990.1.66787 WP_000719990.1.66794 WP_000719990.1.66796 WP_000719990.1.66849 WP_000719990.1.66873 WP_000719990.1.66922 WP_000719990.1.66926 WP_000719990.1.66933 WP_000719990.1.66948 WP_000719990.1.66978 WP_000719990.1.6698 WP_000719990.1.66984 WP_000719990.1.6701 WP_000719990.1.67018 WP_000719990.1.67021 WP_000719990.1.67022 WP_000719990.1.67026 WP_000719990.1.67029 WP_000719990.1.67047 WP_000719990.1.67055 WP_000719990.1.6706 WP_000719990.1.67073 WP_000719990.1.67102 WP_000719990.1.67116 WP_000719990.1.67120 WP_000719990.1.67132 WP_000719990.1.67136 WP_000719990.1.67137 WP_000719990.1.67149 WP_000719990.1.67150 WP_000719990.1.67153 WP_000719990.1.67158 WP_000719990.1.67164 WP_000719990.1.67174 WP_000719990.1.67194 WP_000719990.1.67200 WP_000719990.1.67209 WP_000719990.1.67210 WP_000719990.1.67214 WP_000719990.1.6723 WP_000719990.1.67258 WP_000719990.1.67272 WP_000719990.1.67278 WP_000719990.1.67284 WP_000719990.1.67293 WP_000719990.1.6735 WP_000719990.1.67373 WP_000719990.1.67383 WP_000719990.1.67412 WP_000719990.1.67415 WP_000719990.1.67427 WP_000719990.1.67446 WP_000719990.1.67451 WP_000719990.1.67452 WP_000719990.1.67454 WP_000719990.1.67456 WP_000719990.1.67464 WP_000719990.1.67468 WP_000719990.1.67495 WP_000719990.1.67522 WP_000719990.1.67533 WP_000719990.1.67538 WP_000719990.1.67549 WP_000719990.1.67553 WP_000719990.1.67581 WP_000719990.1.67590 WP_000719990.1.67606 WP_000719990.1.67660 WP_000719990.1.67663 WP_000719990.1.67669 WP_000719990.1.67676 WP_000719990.1.67681 WP_000719990.1.67685 WP_000719990.1.6769 WP_000719990.1.67690 WP_000719990.1.67701 WP_000719990.1.67724 WP_000719990.1.67726 WP_000719990.1.67732 WP_000719990.1.67737 WP_000719990.1.67753 WP_000719990.1.67758 WP_000719990.1.67760 WP_000719990.1.67775 WP_000719990.1.67780 WP_000719990.1.67787 WP_000719990.1.678 WP_000719990.1.67802 WP_000719990.1.67810 WP_000719990.1.67841 WP_000719990.1.67853 WP_000719990.1.67861 WP_000719990.1.67891 WP_000719990.1.67894 WP_000719990.1.6793 WP_000719990.1.67971 WP_000719990.1.67975 WP_000719990.1.67990 WP_000719990.1.67992 WP_000719990.1.67999 WP_000719990.1.68008 WP_000719990.1.68012 WP_000719990.1.6802 WP_000719990.1.68025 WP_000719990.1.6803 WP_000719990.1.68039 WP_000719990.1.68052 WP_000719990.1.68058 WP_000719990.1.68059 WP_000719990.1.68063 WP_000719990.1.68067 WP_000719990.1.68069 WP_000719990.1.68070 WP_000719990.1.68071 WP_000719990.1.68079 WP_000719990.1.68096 WP_000719990.1.6810 WP_000719990.1.68138 WP_000719990.1.6814 WP_000719990.1.68157 WP_000719990.1.68175 WP_000719990.1.68177 WP_000719990.1.682 WP_000719990.1.68215 WP_000719990.1.68231 WP_000719990.1.68241 WP_000719990.1.68255 WP_000719990.1.68271 WP_000719990.1.68278 WP_000719990.1.68279 WP_000719990.1.68283 WP_000719990.1.68292 WP_000719990.1.68300 WP_000719990.1.68336 WP_000719990.1.68341 WP_000719990.1.68347 WP_000719990.1.68362 WP_000719990.1.68372 WP_000719990.1.68395 WP_000719990.1.68396 WP_000719990.1.68411 WP_000719990.1.68441 WP_000719990.1.68442 WP_000719990.1.68490 WP_000719990.1.68493 WP_000719990.1.68523 WP_000719990.1.68524 WP_000719990.1.68534 WP_000719990.1.68566 WP_000719990.1.68572 WP_000719990.1.6859 WP_000719990.1.6860 WP_000719990.1.68609 WP_000719990.1.68632 WP_000719990.1.68673 WP_000719990.1.68678 WP_000719990.1.68697 WP_000719990.1.68701 WP_000719990.1.68711 WP_000719990.1.68735 WP_000719990.1.68750 WP_000719990.1.68751 WP_000719990.1.6877 WP_000719990.1.68793 WP_000719990.1.68795 WP_000719990.1.68797 WP_000719990.1.6880 WP_000719990.1.68801 WP_000719990.1.68838 WP_000719990.1.68847 WP_000719990.1.6887 WP_000719990.1.68877 WP_000719990.1.68911 WP_000719990.1.68915 WP_000719990.1.68936 WP_000719990.1.68942 WP_000719990.1.68952 WP_000719990.1.68956 WP_000719990.1.6897 WP_000719990.1.68989 WP_000719990.1.68995 WP_000719990.1.69033 WP_000719990.1.69054 WP_000719990.1.69098 WP_000719990.1.69126 WP_000719990.1.69127 WP_000719990.1.69158 WP_000719990.1.6916 WP_000719990.1.69160 WP_000719990.1.6921 WP_000719990.1.6923 WP_000719990.1.69247 WP_000719990.1.69258 WP_000719990.1.69261 WP_000719990.1.69303 WP_000719990.1.69305 WP_000719990.1.69327 WP_000719990.1.69341 WP_000719990.1.69350 WP_000719990.1.69351 WP_000719990.1.69382 WP_000719990.1.69390 WP_000719990.1.694 WP_000719990.1.69404 WP_000719990.1.69438 WP_000719990.1.6945 WP_000719990.1.69450 WP_000719990.1.69472 WP_000719990.1.69473 WP_000719990.1.69502 WP_000719990.1.69506 WP_000719990.1.69551 WP_000719990.1.69569 WP_000719990.1.69583 WP_000719990.1.69589 WP_000719990.1.69593 WP_000719990.1.69596 WP_000719990.1.69605 WP_000719990.1.69643 WP_000719990.1.69646 WP_000719990.1.69649 WP_000719990.1.69655 WP_000719990.1.69689 WP_000719990.1.697 WP_000719990.1.69716 WP_000719990.1.69780 WP_000719990.1.69803 WP_000719990.1.69810 WP_000719990.1.69818 WP_000719990.1.69831 WP_000719990.1.69832 WP_000719990.1.69868 WP_000719990.1.69872 WP_000719990.1.69887 WP_000719990.1.69896 WP_000719990.1.6993 WP_000719990.1.69963 WP_000719990.1.69972 WP_000719990.1.69999 WP_000719990.1.7001 WP_000719990.1.70063 WP_000719990.1.701 WP_000719990.1.70123 WP_000719990.1.70125 WP_000719990.1.7013 WP_000719990.1.70149 WP_000719990.1.7015 WP_000719990.1.70190 WP_000719990.1.70191 WP_000719990.1.70200 WP_000719990.1.70213 WP_000719990.1.70230 WP_000719990.1.70251 WP_000719990.1.70300 WP_000719990.1.70337 WP_000719990.1.70341 WP_000719990.1.70357 WP_000719990.1.70370 WP_000719990.1.70386 WP_000719990.1.70407 WP_000719990.1.70408 WP_000719990.1.70414 WP_000719990.1.70477 WP_000719990.1.7050 WP_000719990.1.70517 WP_000719990.1.7052 WP_000719990.1.70539 WP_000719990.1.70563 WP_000719990.1.70576 WP_000719990.1.70578 WP_000719990.1.70582 WP_000719990.1.70592 WP_000719990.1.70619 WP_000719990.1.70628 WP_000719990.1.70655 WP_000719990.1.70686 WP_000719990.1.70694 WP_000719990.1.70698 WP_000719990.1.70705 WP_000719990.1.70713 WP_000719990.1.70723 WP_000719990.1.70745 WP_000719990.1.70748 WP_000719990.1.70767 WP_000719990.1.70787 WP_000719990.1.70794 WP_000719990.1.70801 WP_000719990.1.70803 WP_000719990.1.70896 WP_000719990.1.7090 WP_000719990.1.70900 WP_000719990.1.70952 WP_000719990.1.70967 WP_000719990.1.71003 WP_000719990.1.7102 WP_000719990.1.71024 WP_000719990.1.71042 WP_000719990.1.71062 WP_000719990.1.71099 WP_000719990.1.71109 WP_000719990.1.71113 WP_000719990.1.71134 WP_000719990.1.71139 WP_000719990.1.71144 WP_000719990.1.71147 WP_000719990.1.71149 WP_000719990.1.71158 WP_000719990.1.71159 WP_000719990.1.71162 WP_000719990.1.71176 WP_000719990.1.71183 WP_000719990.1.71199 WP_000719990.1.71205 WP_000719990.1.7121 WP_000719990.1.71221 WP_000719990.1.71225 WP_000719990.1.71226 WP_000719990.1.71229 WP_000719990.1.71269 WP_000719990.1.71272 WP_000719990.1.71275 WP_000719990.1.71285 WP_000719990.1.71287 WP_000719990.1.71294 WP_000719990.1.71311 WP_000719990.1.71312 WP_000719990.1.71315 WP_000719990.1.71323 WP_000719990.1.71327 WP_000719990.1.71339 WP_000719990.1.71354 WP_000719990.1.71397 WP_000719990.1.71403 WP_000719990.1.71405 WP_000719990.1.71409 WP_000719990.1.71421 WP_000719990.1.71423 WP_000719990.1.71448 WP_000719990.1.71480 WP_000719990.1.71522 WP_000719990.1.71533 WP_000719990.1.71537 WP_000719990.1.71538 WP_000719990.1.71540 WP_000719990.1.71562 WP_000719990.1.71563 WP_000719990.1.71607 WP_000719990.1.71632 WP_000719990.1.71680 WP_000719990.1.71690 WP_000719990.1.71695 WP_000719990.1.71724 WP_000719990.1.71732 WP_000719990.1.71757 WP_000719990.1.71767 WP_000719990.1.71783 WP_000719990.1.71830 WP_000719990.1.71837 WP_000719990.1.71840 WP_000719990.1.71855 WP_000719990.1.71856 WP_000719990.1.71874 WP_000719990.1.71912 WP_000719990.1.7192 WP_000719990.1.71938 WP_000719990.1.71940 WP_000719990.1.71967 WP_000719990.1.71972 WP_000719990.1.71975 WP_000719990.1.71987 WP_000719990.1.71995 WP_000719990.1.72013 WP_000719990.1.72016 WP_000719990.1.72021 WP_000719990.1.72028 WP_000719990.1.72033 WP_000719990.1.72048 WP_000719990.1.7205 WP_000719990.1.72053 WP_000719990.1.72066 WP_000719990.1.72090 WP_000719990.1.72098 WP_000719990.1.7210 WP_000719990.1.72117 WP_000719990.1.72125 WP_000719990.1.72141 WP_000719990.1.72153 WP_000719990.1.72155 WP_000719990.1.72157 WP_000719990.1.72162 WP_000719990.1.72180 WP_000719990.1.72184 WP_000719990.1.72186 WP_000719990.1.72208 WP_000719990.1.72212 WP_000719990.1.72240 WP_000719990.1.72248 WP_000719990.1.7225 WP_000719990.1.72258 WP_000719990.1.72261 WP_000719990.1.72270 WP_000719990.1.72279 WP_000719990.1.72298 WP_000719990.1.723 WP_000719990.1.72316 WP_000719990.1.72337 WP_000719990.1.72342 WP_000719990.1.72352 WP_000719990.1.72359 WP_000719990.1.72388 WP_000719990.1.72397 WP_000719990.1.72425 WP_000719990.1.72427 WP_000719990.1.72431 WP_000719990.1.72436 WP_000719990.1.72449 WP_000719990.1.72469 WP_000719990.1.72485 WP_000719990.1.72493 WP_000719990.1.72507 WP_000719990.1.72511 WP_000719990.1.72521 WP_000719990.1.72522 WP_000719990.1.72535 WP_000719990.1.72537 WP_000719990.1.72544 WP_000719990.1.72551 WP_000719990.1.72582 WP_000719990.1.72588 WP_000719990.1.72596 WP_000719990.1.72599 WP_000719990.1.72606 WP_000719990.1.72614 WP_000719990.1.72615 WP_000719990.1.72616 WP_000719990.1.72619 WP_000719990.1.72641 WP_000719990.1.72643 WP_000719990.1.72663 WP_000719990.1.72694 WP_000719990.1.72700 WP_000719990.1.72706 WP_000719990.1.72725 WP_000719990.1.72729 WP_000719990.1.72745 WP_000719990.1.72747 WP_000719990.1.72748 WP_000719990.1.72751 WP_000719990.1.72758 WP_000719990.1.72764 WP_000719990.1.7277 WP_000719990.1.72778 WP_000719990.1.72806 WP_000719990.1.7281 WP_000719990.1.72837 WP_000719990.1.72857 WP_000719990.1.72858 WP_000719990.1.72860 WP_000719990.1.72869 WP_000719990.1.72893 WP_000719990.1.7291 WP_000719990.1.72910 WP_000719990.1.72913 WP_000719990.1.72947 WP_000719990.1.72950 WP_000719990.1.72956 WP_000719990.1.72962 WP_000719990.1.73000 WP_000719990.1.73010 WP_000719990.1.73032 WP_000719990.1.73039 WP_000719990.1.73061 WP_000719990.1.7307 WP_000719990.1.73072 WP_000719990.1.73075 WP_000719990.1.73085 WP_000719990.1.7309 WP_000719990.1.73126 WP_000719990.1.73129 WP_000719990.1.73197 WP_000719990.1.73215 WP_000719990.1.73217 WP_000719990.1.73230 WP_000719990.1.73239 WP_000719990.1.73243 WP_000719990.1.73249 WP_000719990.1.73251 WP_000719990.1.73257 WP_000719990.1.73259 WP_000719990.1.73277 WP_000719990.1.73291 WP_000719990.1.73292 WP_000719990.1.73295 WP_000719990.1.73326 WP_000719990.1.73333 WP_000719990.1.73343 WP_000719990.1.73344 WP_000719990.1.73349 WP_000719990.1.73385 WP_000719990.1.73428 WP_000719990.1.73430 WP_000719990.1.7345 WP_000719990.1.73468 WP_000719990.1.73486 WP_000719990.1.7349 WP_000719990.1.73524 WP_000719990.1.73565 WP_000719990.1.73572 WP_000719990.1.73604 WP_000719990.1.73626 WP_000719990.1.73663 WP_000719990.1.73700 WP_000719990.1.73709 WP_000719990.1.73717 WP_000719990.1.73743 WP_000719990.1.73748 WP_000719990.1.7376 WP_000719990.1.73783 WP_000719990.1.73785 WP_000719990.1.73797 WP_000719990.1.73801 WP_000719990.1.73807 WP_000719990.1.73811 WP_000719990.1.73827 WP_000719990.1.73835 WP_000719990.1.73843 WP_000719990.1.73844 WP_000719990.1.73859 WP_000719990.1.73882 WP_000719990.1.73897 WP_000719990.1.73908 WP_000719990.1.7392 WP_000719990.1.73934 WP_000719990.1.73942 WP_000719990.1.73968 WP_000719990.1.73995 WP_000719990.1.73996 WP_000719990.1.74032 WP_000719990.1.74041 WP_000719990.1.74046 WP_000719990.1.74051 WP_000719990.1.7407 WP_000719990.1.7411 WP_000719990.1.74123 WP_000719990.1.7413 WP_000719990.1.74156 WP_000719990.1.74184 WP_000719990.1.74185 WP_000719990.1.7424 WP_000719990.1.74243 WP_000719990.1.7425 WP_000719990.1.74251 WP_000719990.1.74267 WP_000719990.1.7429 WP_000719990.1.74309 WP_000719990.1.74358 WP_000719990.1.74365 WP_000719990.1.74367 WP_000719990.1.744 WP_000719990.1.74423 WP_000719990.1.74426 WP_000719990.1.74431 WP_000719990.1.74444 WP_000719990.1.74445 WP_000719990.1.7446 WP_000719990.1.74478 WP_000719990.1.74491 WP_000719990.1.74501 WP_000719990.1.74509 WP_000719990.1.74513 WP_000719990.1.74520 WP_000719990.1.74521 WP_000719990.1.74528 WP_000719990.1.74532 WP_000719990.1.74536 WP_000719990.1.74549 WP_000719990.1.74557 WP_000719990.1.74574 WP_000719990.1.7461 WP_000719990.1.74611 WP_000719990.1.74623 WP_000719990.1.74624 WP_000719990.1.74625 WP_000719990.1.74631 WP_000719990.1.74652 WP_000719990.1.74670 WP_000719990.1.74682 WP_000719990.1.74687 WP_000719990.1.74688 WP_000719990.1.74689 WP_000719990.1.74691 WP_000719990.1.74705 WP_000719990.1.74713 WP_000719990.1.74720 WP_000719990.1.74735 WP_000719990.1.74752 WP_000719990.1.74765 WP_000719990.1.74767 WP_000719990.1.7479 WP_000719990.1.74793 WP_000719990.1.74811 WP_000719990.1.74828 WP_000719990.1.74844 WP_000719990.1.74852 WP_000719990.1.74860 WP_000719990.1.74880 WP_000719990.1.74885 WP_000719990.1.74889 WP_000719990.1.74895 WP_000719990.1.74904 WP_000719990.1.74915 WP_000719990.1.74962 WP_000719990.1.74993 WP_000719990.1.74998 WP_000719990.1.75021 WP_000719990.1.75029 WP_000719990.1.75030 WP_000719990.1.75050 WP_000719990.1.75087 WP_000719990.1.75100 WP_000719990.1.75112 WP_000719990.1.75118 WP_000719990.1.75124 WP_000719990.1.75136 WP_000719990.1.75139 WP_000719990.1.75145 WP_000719990.1.75149 WP_000719990.1.75155 WP_000719990.1.7516 WP_000719990.1.75164 WP_000719990.1.75181 WP_000719990.1.75209 WP_000719990.1.75248 WP_000719990.1.75254 WP_000719990.1.75270 WP_000719990.1.75272 WP_000719990.1.7536 WP_000719990.1.75360 WP_000719990.1.75367 WP_000719990.1.75382 WP_000719990.1.7539 WP_000719990.1.75419 WP_000719990.1.75428 WP_000719990.1.75435 WP_000719990.1.75465 WP_000719990.1.75491 WP_000719990.1.75505 WP_000719990.1.75507 WP_000719990.1.75515 WP_000719990.1.75529 WP_000719990.1.75536 WP_000719990.1.75537 WP_000719990.1.75577 WP_000719990.1.75588 WP_000719990.1.75594 WP_000719990.1.75612 WP_000719990.1.75629 WP_000719990.1.75644 WP_000719990.1.75672 WP_000719990.1.75676 WP_000719990.1.75679 WP_000719990.1.75687 WP_000719990.1.75694 WP_000719990.1.75696 WP_000719990.1.75699 WP_000719990.1.75735 WP_000719990.1.75758 WP_000719990.1.75767 WP_000719990.1.75786 WP_000719990.1.75808 WP_000719990.1.7583 WP_000719990.1.75839 WP_000719990.1.75853 WP_000719990.1.75892 WP_000719990.1.75918 WP_000719990.1.75922 WP_000719990.1.7597 WP_000719990.1.75983 WP_000719990.1.75989 WP_000719990.1.75995 WP_000719990.1.75999 WP_000719990.1.76005 WP_000719990.1.76009 WP_000719990.1.76019 WP_000719990.1.7603 WP_000719990.1.76030 WP_000719990.1.76036 WP_000719990.1.76039 WP_000719990.1.76054 WP_000719990.1.76057 WP_000719990.1.7608 WP_000719990.1.76087 WP_000719990.1.76103 WP_000719990.1.76119 WP_000719990.1.76129 WP_000719990.1.7613 WP_000719990.1.76152 WP_000719990.1.7617 WP_000719990.1.76184 WP_000719990.1.76189 WP_000719990.1.76194 WP_000719990.1.76196 WP_000719990.1.76237 WP_000719990.1.76268 WP_000719990.1.76269 WP_000719990.1.76305 WP_000719990.1.76325 WP_000719990.1.76335 WP_000719990.1.76361 WP_000719990.1.76376 WP_000719990.1.76384 WP_000719990.1.76387 WP_000719990.1.76390 WP_000719990.1.76407 WP_000719990.1.76446 WP_000719990.1.76447 WP_000719990.1.76448 WP_000719990.1.76452 WP_000719990.1.76460 WP_000719990.1.76462 WP_000719990.1.76469 WP_000719990.1.76477 WP_000719990.1.76504 WP_000719990.1.76542 WP_000719990.1.76547 WP_000719990.1.76562 WP_000719990.1.76596 WP_000719990.1.76619 WP_000719990.1.76643 WP_000719990.1.76656 WP_000719990.1.76660 WP_000719990.1.76697 WP_000719990.1.76701 WP_000719990.1.76707 WP_000719990.1.76712 WP_000719990.1.76751 WP_000719990.1.76759 WP_000719990.1.7680 WP_000719990.1.76815 WP_000719990.1.76827 WP_000719990.1.76840 WP_000719990.1.76863 WP_000719990.1.76909 WP_000719990.1.76918 WP_000719990.1.76933 WP_000719990.1.76948 WP_000719990.1.76957 WP_000719990.1.76961 WP_000719990.1.76965 WP_000719990.1.76966 WP_000719990.1.7699 WP_000719990.1.76994 WP_000719990.1.77007 WP_000719990.1.77022 WP_000719990.1.77036 WP_000719990.1.77042 WP_000719990.1.77057 WP_000719990.1.77070 WP_000719990.1.77081 WP_000719990.1.77099 WP_000719990.1.771 WP_000719990.1.77109 WP_000719990.1.77128 WP_000719990.1.77134 WP_000719990.1.77147 WP_000719990.1.77162 WP_000719990.1.77163 WP_000719990.1.77175 WP_000719990.1.77198 WP_000719990.1.77200 WP_000719990.1.77204 WP_000719990.1.77214 WP_000719990.1.77224 WP_000719990.1.77239 WP_000719990.1.77253 WP_000719990.1.77255 WP_000719990.1.77258 WP_000719990.1.77275 WP_000719990.1.7728 WP_000719990.1.77284 WP_000719990.1.7729 WP_000719990.1.77290 WP_000719990.1.77291 WP_000719990.1.7731 WP_000719990.1.77320 WP_000719990.1.77326 WP_000719990.1.77341 WP_000719990.1.77358 WP_000719990.1.77392 WP_000719990.1.77408 WP_000719990.1.77419 WP_000719990.1.77432 WP_000719990.1.77455 WP_000719990.1.77462 WP_000719990.1.7747 WP_000719990.1.77470 WP_000719990.1.77477 WP_000719990.1.77481 WP_000719990.1.77487 WP_000719990.1.77495 WP_000719990.1.775 WP_000719990.1.7750 WP_000719990.1.77503 WP_000719990.1.77511 WP_000719990.1.77542 WP_000719990.1.77581 WP_000719990.1.77595 WP_000719990.1.77608 WP_000719990.1.77626 WP_000719990.1.77636 WP_000719990.1.77643 WP_000719990.1.77644 WP_000719990.1.77648 WP_000719990.1.77657 WP_000719990.1.77707 WP_000719990.1.77741 WP_000719990.1.7775 WP_000719990.1.77760 WP_000719990.1.77768 WP_000719990.1.7780 WP_000719990.1.7781 WP_000719990.1.77813 WP_000719990.1.77816 WP_000719990.1.77826 WP_000719990.1.77833 WP_000719990.1.77876 WP_000719990.1.77929 WP_000719990.1.77949 WP_000719990.1.77950 WP_000719990.1.77961 WP_000719990.1.77979 WP_000719990.1.7799 WP_000719990.1.78000 WP_000719990.1.78007 WP_000719990.1.78010 WP_000719990.1.7804 WP_000719990.1.78041 WP_000719990.1.78063 WP_000719990.1.7808 WP_000719990.1.78089 WP_000719990.1.78097 WP_000719990.1.78099 WP_000719990.1.78101 WP_000719990.1.78102 WP_000719990.1.78131 WP_000719990.1.78183 WP_000719990.1.78187 WP_000719990.1.78188 WP_000719990.1.78196 WP_000719990.1.78202 WP_000719990.1.78232 WP_000719990.1.78233 WP_000719990.1.78235 WP_000719990.1.78305 WP_000719990.1.78321 WP_000719990.1.78323 WP_000719990.1.78368 WP_000719990.1.78376 WP_000719990.1.78377 WP_000719990.1.784 WP_000719990.1.78445 WP_000719990.1.78453 WP_000719990.1.78462 WP_000719990.1.78463 WP_000719990.1.7847 WP_000719990.1.78491 WP_000719990.1.78512 WP_000719990.1.78515 WP_000719990.1.78527 WP_000719990.1.7855 WP_000719990.1.78572 WP_000719990.1.78575 WP_000719990.1.78581 WP_000719990.1.78583 WP_000719990.1.78586 WP_000719990.1.78593 WP_000719990.1.78610 WP_000719990.1.78611 WP_000719990.1.78612 WP_000719990.1.78615 WP_000719990.1.78622 WP_000719990.1.78677 WP_000719990.1.78683 WP_000719990.1.78687 WP_000719990.1.78689 WP_000719990.1.78698 WP_000719990.1.78706 WP_000719990.1.78714 WP_000719990.1.78718 WP_000719990.1.78757 WP_000719990.1.78773 WP_000719990.1.78775 WP_000719990.1.78791 WP_000719990.1.78814 WP_000719990.1.7883 WP_000719990.1.78843 WP_000719990.1.78845 WP_000719990.1.78854 WP_000719990.1.78888 WP_000719990.1.78891 WP_000719990.1.78893 WP_000719990.1.78895 WP_000719990.1.78908 WP_000719990.1.78919 WP_000719990.1.78953 WP_000719990.1.78955 WP_000719990.1.78956 WP_000719990.1.7896 WP_000719990.1.78966 WP_000719990.1.7898 WP_000719990.1.78996 WP_000719990.1.79001 WP_000719990.1.79004 WP_000719990.1.7901 WP_000719990.1.79067 WP_000719990.1.79075 WP_000719990.1.79086 WP_000719990.1.79092 WP_000719990.1.79100 WP_000719990.1.79159 WP_000719990.1.79172 WP_000719990.1.79243 WP_000719990.1.79246 WP_000719990.1.79248 WP_000719990.1.79249 WP_000719990.1.79276 WP_000719990.1.79306 WP_000719990.1.79312 WP_000719990.1.79342 WP_000719990.1.79343 WP_000719990.1.79346 WP_000719990.1.79348 WP_000719990.1.79356 WP_000719990.1.79365 WP_000719990.1.79368 WP_000719990.1.79369 WP_000719990.1.7937 WP_000719990.1.79389 WP_000719990.1.79391 WP_000719990.1.7940 WP_000719990.1.79409 WP_000719990.1.79414 WP_000719990.1.79443 WP_000719990.1.79464 WP_000719990.1.79478 WP_000719990.1.79505 WP_000719990.1.79519 WP_000719990.1.7952 WP_000719990.1.79525 WP_000719990.1.79526 WP_000719990.1.79528 WP_000719990.1.79540 WP_000719990.1.79558 WP_000719990.1.79563 WP_000719990.1.79576 WP_000719990.1.79591 WP_000719990.1.79606 WP_000719990.1.79619 WP_000719990.1.79640 WP_000719990.1.7967 WP_000719990.1.79685 WP_000719990.1.79707 WP_000719990.1.79713 WP_000719990.1.79715 WP_000719990.1.79749 WP_000719990.1.79764 WP_000719990.1.79800 WP_000719990.1.79816 WP_000719990.1.79824 WP_000719990.1.79840 WP_000719990.1.7985 WP_000719990.1.79866 WP_000719990.1.79869 WP_000719990.1.79871 WP_000719990.1.79877 WP_000719990.1.79905 WP_000719990.1.79922 WP_000719990.1.79930 WP_000719990.1.79931 WP_000719990.1.79932 WP_000719990.1.79933 WP_000719990.1.79936 WP_000719990.1.79944 WP_000719990.1.79952 WP_000719990.1.79955 WP_000719990.1.79965 WP_000719990.1.79973 WP_000719990.1.79984 WP_000719990.1.79995 WP_000719990.1.80 WP_000719990.1.80016 WP_000719990.1.80026 WP_000719990.1.8004 WP_000719990.1.80050 WP_000719990.1.80060 WP_000719990.1.80061 WP_000719990.1.80063 WP_000719990.1.8007 WP_000719990.1.80071 WP_000719990.1.80096 WP_000719990.1.80106 WP_000719990.1.8011 WP_000719990.1.80112 WP_000719990.1.80136 WP_000719990.1.80141 WP_000719990.1.80168 WP_000719990.1.80176 WP_000719990.1.80179 WP_000719990.1.80183 WP_000719990.1.80255 WP_000719990.1.80292 WP_000719990.1.80309 WP_000719990.1.80320 WP_000719990.1.80330 WP_000719990.1.80343 WP_000719990.1.80392 WP_000719990.1.804 WP_000719990.1.80402 WP_000719990.1.80426 WP_000719990.1.80428 WP_000719990.1.80440 WP_000719990.1.80444 WP_000719990.1.80463 WP_000719990.1.80484 WP_000719990.1.80517 WP_000719990.1.80519 WP_000719990.1.80524 WP_000719990.1.80558 WP_000719990.1.80559 WP_000719990.1.8057 WP_000719990.1.80577 WP_000719990.1.80578 WP_000719990.1.80606 WP_000719990.1.80612 WP_000719990.1.80626 WP_000719990.1.80660 WP_000719990.1.80662 WP_000719990.1.8068 WP_000719990.1.80709 WP_000719990.1.80736 WP_000719990.1.80737 WP_000719990.1.80753 WP_000719990.1.80754 WP_000719990.1.80756 WP_000719990.1.8076 WP_000719990.1.80768 WP_000719990.1.80789 WP_000719990.1.80804 WP_000719990.1.80805 WP_000719990.1.80843 WP_000719990.1.80884 WP_000719990.1.80894 WP_000719990.1.8090 WP_000719990.1.80935 WP_000719990.1.80945 WP_000719990.1.80946 WP_000719990.1.80948 WP_000719990.1.80966 WP_000719990.1.80985 WP_000719990.1.810 WP_000719990.1.81026 WP_000719990.1.81032 WP_000719990.1.81034 WP_000719990.1.81036 WP_000719990.1.81054 WP_000719990.1.81056 WP_000719990.1.81070 WP_000719990.1.81098 WP_000719990.1.811 WP_000719990.1.81104 WP_000719990.1.81120 WP_000719990.1.81127 WP_000719990.1.81141 WP_000719990.1.81156 WP_000719990.1.81160 WP_000719990.1.81165 WP_000719990.1.8118 WP_000719990.1.81182 WP_000719990.1.81186 WP_000719990.1.8121 WP_000719990.1.81219 WP_000719990.1.81266 WP_000719990.1.81267 WP_000719990.1.81273 WP_000719990.1.81283 WP_000719990.1.81286 WP_000719990.1.81313 WP_000719990.1.81316 WP_000719990.1.81323 WP_000719990.1.81347 WP_000719990.1.81376 WP_000719990.1.81391 WP_000719990.1.81396 WP_000719990.1.814 WP_000719990.1.81418 WP_000719990.1.81420 WP_000719990.1.81438 WP_000719990.1.81442 WP_000719990.1.81469 WP_000719990.1.81475 WP_000719990.1.81484 WP_000719990.1.81514 WP_000719990.1.81517 WP_000719990.1.81576 WP_000719990.1.81577 WP_000719990.1.81580 WP_000719990.1.81582 WP_000719990.1.81588 WP_000719990.1.81589 WP_000719990.1.81596 WP_000719990.1.81618 WP_000719990.1.81624 WP_000719990.1.81625 WP_000719990.1.81688 WP_000719990.1.81715 WP_000719990.1.8172 WP_000719990.1.81723 WP_000719990.1.81754 WP_000719990.1.81761 WP_000719990.1.81806 WP_000719990.1.81819 WP_000719990.1.81821 WP_000719990.1.8183 WP_000719990.1.81832 WP_000719990.1.81869 WP_000719990.1.81873 WP_000719990.1.81876 WP_000719990.1.81888 WP_000719990.1.81914 WP_000719990.1.81934 WP_000719990.1.81935 WP_000719990.1.81939 WP_000719990.1.81956 WP_000719990.1.81972 WP_000719990.1.81975 WP_000719990.1.82 WP_000719990.1.82008 WP_000719990.1.82010 WP_000719990.1.82057 WP_000719990.1.82059 WP_000719990.1.82074 WP_000719990.1.82104 WP_000719990.1.82106 WP_000719990.1.82123 WP_000719990.1.82137 WP_000719990.1.82166 WP_000719990.1.82217 WP_000719990.1.82221 WP_000719990.1.82239 WP_000719990.1.82240 WP_000719990.1.82242 WP_000719990.1.82246 WP_000719990.1.82275 WP_000719990.1.82296 WP_000719990.1.82316 WP_000719990.1.82326 WP_000719990.1.8235 WP_000719990.1.82378 WP_000719990.1.82439 WP_000719990.1.82485 WP_000719990.1.82499 WP_000719990.1.82507 WP_000719990.1.82514 WP_000719990.1.82527 WP_000719990.1.82536 WP_000719990.1.82539 WP_000719990.1.8255 WP_000719990.1.82572 WP_000719990.1.82589 WP_000719990.1.82594 WP_000719990.1.82629 WP_000719990.1.82647 WP_000719990.1.82661 WP_000719990.1.8268 WP_000719990.1.82691 WP_000719990.1.82700 WP_000719990.1.82711 WP_000719990.1.82715 WP_000719990.1.82718 WP_000719990.1.82747 WP_000719990.1.82754 WP_000719990.1.8277 WP_000719990.1.82776 WP_000719990.1.82780 WP_000719990.1.82784 WP_000719990.1.82797 WP_000719990.1.82799 WP_000719990.1.82816 WP_000719990.1.82820 WP_000719990.1.82831 WP_000719990.1.82833 WP_000719990.1.82853 WP_000719990.1.82901 WP_000719990.1.82902 WP_000719990.1.82923 WP_000719990.1.8295 WP_000719990.1.82991 WP_000719990.1.83020 WP_000719990.1.83035 WP_000719990.1.83036 WP_000719990.1.83051 WP_000719990.1.83059 WP_000719990.1.8306 WP_000719990.1.8308 WP_000719990.1.83093 WP_000719990.1.83097 WP_000719990.1.83099 WP_000719990.1.831 WP_000719990.1.83118 WP_000719990.1.83125 WP_000719990.1.83127 WP_000719990.1.83140 WP_000719990.1.83144 WP_000719990.1.83151 WP_000719990.1.83218 WP_000719990.1.83224 WP_000719990.1.83238 WP_000719990.1.83253 WP_000719990.1.83256 WP_000719990.1.83286 WP_000719990.1.83313 WP_000719990.1.83321 WP_000719990.1.83340 WP_000719990.1.83347 WP_000719990.1.83375 WP_000719990.1.83393 WP_000719990.1.83415 WP_000719990.1.8345 WP_000719990.1.83481 WP_000719990.1.83506 WP_000719990.1.83537 WP_000719990.1.83544 WP_000719990.1.83564 WP_000719990.1.83582 WP_000719990.1.83644 WP_000719990.1.8368 WP_000719990.1.83684 WP_000719990.1.83706 WP_000719990.1.83712 WP_000719990.1.83735 WP_000719990.1.83762 WP_000719990.1.83781 WP_000719990.1.83807 WP_000719990.1.83820 WP_000719990.1.8384 WP_000719990.1.8386 WP_000719990.1.83879 WP_000719990.1.83911 WP_000719990.1.83936 WP_000719990.1.83941 WP_000719990.1.83947 WP_000719990.1.84014 WP_000719990.1.84021 WP_000719990.1.8405 WP_000719990.1.84059 WP_000719990.1.84060 WP_000719990.1.8408 WP_000719990.1.84140 WP_000719990.1.84164 WP_000719990.1.84172 WP_000719990.1.84197 WP_000719990.1.84210 WP_000719990.1.84215 WP_000719990.1.84219 WP_000719990.1.84221 WP_000719990.1.84264 WP_000719990.1.84298 WP_000719990.1.84312 WP_000719990.1.84313 WP_000719990.1.84316 WP_000719990.1.84326 WP_000719990.1.84331 WP_000719990.1.84339 WP_000719990.1.84348 WP_000719990.1.84402 WP_000719990.1.84405 WP_000719990.1.84410 WP_000719990.1.84436 WP_000719990.1.8444 WP_000719990.1.84464 WP_000719990.1.8447 WP_000719990.1.84473 WP_000719990.1.84476 WP_000719990.1.84482 WP_000719990.1.84484 WP_000719990.1.84486 WP_000719990.1.84511 WP_000719990.1.84518 WP_000719990.1.84531 WP_000719990.1.84534 WP_000719990.1.84584 WP_000719990.1.84635 WP_000719990.1.84639 WP_000719990.1.84656 WP_000719990.1.84657 WP_000719990.1.84668 WP_000719990.1.84675 WP_000719990.1.84697 WP_000719990.1.8470 WP_000719990.1.84738 WP_000719990.1.84740 WP_000719990.1.8477 WP_000719990.1.84784 WP_000719990.1.84797 WP_000719990.1.84841 WP_000719990.1.84850 WP_000719990.1.84875 WP_000719990.1.84877 WP_000719990.1.84878 WP_000719990.1.84881 WP_000719990.1.84893 WP_000719990.1.84894 WP_000719990.1.84916 WP_000719990.1.84929 WP_000719990.1.84941 WP_000719990.1.84948 WP_000719990.1.84966 WP_000719990.1.84972 WP_000719990.1.84977 WP_000719990.1.84986 WP_000719990.1.84989 WP_000719990.1.84990 WP_000719990.1.85002 WP_000719990.1.85008 WP_000719990.1.85011 WP_000719990.1.85025 WP_000719990.1.85048 WP_000719990.1.85077 WP_000719990.1.85085 WP_000719990.1.85090 WP_000719990.1.85098 WP_000719990.1.85105 WP_000719990.1.85106 WP_000719990.1.85112 WP_000719990.1.85125 WP_000719990.1.85138 WP_000719990.1.85155 WP_000719990.1.8517 WP_000719990.1.85175 WP_000719990.1.85188 WP_000719990.1.85216 WP_000719990.1.85247 WP_000719990.1.85252 WP_000719990.1.85253 WP_000719990.1.85255 WP_000719990.1.85260 WP_000719990.1.85310 WP_000719990.1.85315 WP_000719990.1.85320 WP_000719990.1.85323 WP_000719990.1.85329 WP_000719990.1.85336 WP_000719990.1.85342 WP_000719990.1.85384 WP_000719990.1.85416 WP_000719990.1.85435 WP_000719990.1.85500 WP_000719990.1.85504 WP_000719990.1.85546 WP_000719990.1.85554 WP_000719990.1.85556 WP_000719990.1.85558 WP_000719990.1.85563 WP_000719990.1.85578 WP_000719990.1.85593 WP_000719990.1.8560 WP_000719990.1.85601 WP_000719990.1.85621 WP_000719990.1.85623 WP_000719990.1.8564 WP_000719990.1.85657 WP_000719990.1.85722 WP_000719990.1.85752 WP_000719990.1.85762 WP_000719990.1.85772 WP_000719990.1.85781 WP_000719990.1.8579 WP_000719990.1.85806 WP_000719990.1.85857 WP_000719990.1.8592 WP_000719990.1.85939 WP_000719990.1.85944 WP_000719990.1.85948 WP_000719990.1.85969 WP_000719990.1.86001 WP_000719990.1.86016 WP_000719990.1.8603 WP_000719990.1.86035 WP_000719990.1.8607 WP_000719990.1.86104 WP_000719990.1.86105 WP_000719990.1.86110 WP_000719990.1.86115 WP_000719990.1.86145 WP_000719990.1.86149 WP_000719990.1.86161 WP_000719990.1.86166 WP_000719990.1.86171 WP_000719990.1.86176 WP_000719990.1.86179 WP_000719990.1.86181 WP_000719990.1.86196 WP_000719990.1.8621 WP_000719990.1.86210 WP_000719990.1.86225 WP_000719990.1.86227 WP_000719990.1.86228 WP_000719990.1.86234 WP_000719990.1.86255 WP_000719990.1.86261 WP_000719990.1.86263 WP_000719990.1.86266 WP_000719990.1.86273 WP_000719990.1.86276 WP_000719990.1.86280 WP_000719990.1.86283 WP_000719990.1.86294 WP_000719990.1.86307 WP_000719990.1.86340 WP_000719990.1.8635 WP_000719990.1.86353 WP_000719990.1.86355 WP_000719990.1.86364 WP_000719990.1.86371 WP_000719990.1.86376 WP_000719990.1.86393 WP_000719990.1.86411 WP_000719990.1.86412 WP_000719990.1.86437 WP_000719990.1.86451 WP_000719990.1.86452 WP_000719990.1.86454 WP_000719990.1.86461 WP_000719990.1.86475 WP_000719990.1.86483 WP_000719990.1.8652 WP_000719990.1.8656 WP_000719990.1.86560 WP_000719990.1.86574 WP_000719990.1.86583 WP_000719990.1.86586 WP_000719990.1.86598 WP_000719990.1.86609 WP_000719990.1.86613 WP_000719990.1.86617 WP_000719990.1.86627 WP_000719990.1.86640 WP_000719990.1.86667 WP_000719990.1.86673 WP_000719990.1.86674 WP_000719990.1.86681 WP_000719990.1.86691 WP_000719990.1.86707 WP_000719990.1.86717 WP_000719990.1.86727 WP_000719990.1.86731 WP_000719990.1.86734 WP_000719990.1.86753 WP_000719990.1.86760 WP_000719990.1.86768 WP_000719990.1.86787 WP_000719990.1.86788 WP_000719990.1.8679 WP_000719990.1.86833 WP_000719990.1.86848 WP_000719990.1.8687 WP_000719990.1.86935 WP_000719990.1.86956 WP_000719990.1.86959 WP_000719990.1.86975 WP_000719990.1.86994 WP_000719990.1.86997 WP_000719990.1.87043 WP_000719990.1.8705 WP_000719990.1.87067 WP_000719990.1.87074 WP_000719990.1.87075 WP_000719990.1.87076 WP_000719990.1.87102 WP_000719990.1.87109 WP_000719990.1.8711 WP_000719990.1.87147 WP_000719990.1.87177 WP_000719990.1.87189 WP_000719990.1.87199 WP_000719990.1.87205 WP_000719990.1.87247 WP_000719990.1.87249 WP_000719990.1.87254 WP_000719990.1.87310 WP_000719990.1.87339 WP_000719990.1.87358 WP_000719990.1.87371 WP_000719990.1.87382 WP_000719990.1.87389 WP_000719990.1.87400 WP_000719990.1.87443 WP_000719990.1.87465 WP_000719990.1.87491 WP_000719990.1.87504 WP_000719990.1.87557 WP_000719990.1.87563 WP_000719990.1.87568 WP_000719990.1.87574 WP_000719990.1.87581 WP_000719990.1.87590 WP_000719990.1.87607 WP_000719990.1.87610 WP_000719990.1.87616 WP_000719990.1.87633 WP_000719990.1.87635 WP_000719990.1.87639 WP_000719990.1.87655 WP_000719990.1.87675 WP_000719990.1.87694 WP_000719990.1.87696 WP_000719990.1.87721 WP_000719990.1.87726 WP_000719990.1.87728 WP_000719990.1.87738 WP_000719990.1.87766 WP_000719990.1.8778 WP_000719990.1.87788 WP_000719990.1.87789 WP_000719990.1.87834 WP_000719990.1.87857 WP_000719990.1.87883 WP_000719990.1.87914 WP_000719990.1.87919 WP_000719990.1.87973 WP_000719990.1.87976 WP_000719990.1.87980 WP_000719990.1.880 WP_000719990.1.88017 WP_000719990.1.88020 WP_000719990.1.8807 WP_000719990.1.88082 WP_000719990.1.88088 WP_000719990.1.88110 WP_000719990.1.88119 WP_000719990.1.88147 WP_000719990.1.88149 WP_000719990.1.88155 WP_000719990.1.88197 WP_000719990.1.8822 WP_000719990.1.88234 WP_000719990.1.88238 WP_000719990.1.88252 WP_000719990.1.88260 WP_000719990.1.88285 WP_000719990.1.88301 WP_000719990.1.88304 WP_000719990.1.88336 WP_000719990.1.88376 WP_000719990.1.88379 WP_000719990.1.88384 WP_000719990.1.88427 WP_000719990.1.8843 WP_000719990.1.88434 WP_000719990.1.88462 WP_000719990.1.88467 WP_000719990.1.8848 WP_000719990.1.88499 WP_000719990.1.88505 WP_000719990.1.88524 WP_000719990.1.88527 WP_000719990.1.88528 WP_000719990.1.88535 WP_000719990.1.88539 WP_000719990.1.8855 WP_000719990.1.88557 WP_000719990.1.88562 WP_000719990.1.88598 WP_000719990.1.88607 WP_000719990.1.88631 WP_000719990.1.88646 WP_000719990.1.88667 WP_000719990.1.88678 WP_000719990.1.88686 WP_000719990.1.88709 WP_000719990.1.88710 WP_000719990.1.88711 WP_000719990.1.88717 WP_000719990.1.88720 WP_000719990.1.8873 WP_000719990.1.88732 WP_000719990.1.88735 WP_000719990.1.88752 WP_000719990.1.88757 WP_000719990.1.88759 WP_000719990.1.88767 WP_000719990.1.8879 WP_000719990.1.88793 WP_000719990.1.88803 WP_000719990.1.88826 WP_000719990.1.88834 WP_000719990.1.88880 WP_000719990.1.88883 WP_000719990.1.88891 WP_000719990.1.88941 WP_000719990.1.88953 WP_000719990.1.88961 WP_000719990.1.88997 WP_000719990.1.89043 WP_000719990.1.89050 WP_000719990.1.8906 WP_000719990.1.89067 WP_000719990.1.89069 WP_000719990.1.89090 WP_000719990.1.89099 WP_000719990.1.89150 WP_000719990.1.89163 WP_000719990.1.89165 WP_000719990.1.89183 WP_000719990.1.89197 WP_000719990.1.89200 WP_000719990.1.89203 WP_000719990.1.89214 WP_000719990.1.89217 WP_000719990.1.89255 WP_000719990.1.8928 WP_000719990.1.89285 WP_000719990.1.89305 WP_000719990.1.89322 WP_000719990.1.89334 WP_000719990.1.89335 WP_000719990.1.89351 WP_000719990.1.89379 WP_000719990.1.8938 WP_000719990.1.89385 WP_000719990.1.89396 WP_000719990.1.894 WP_000719990.1.89400 WP_000719990.1.89405 WP_000719990.1.89416 WP_000719990.1.89427 WP_000719990.1.89432 WP_000719990.1.8945 WP_000719990.1.89455 WP_000719990.1.89458 WP_000719990.1.89468 WP_000719990.1.89469 WP_000719990.1.89471 WP_000719990.1.89474 WP_000719990.1.89479 WP_000719990.1.89492 WP_000719990.1.89551 WP_000719990.1.89569 WP_000719990.1.89601 WP_000719990.1.89627 WP_000719990.1.89631 WP_000719990.1.89656 WP_000719990.1.89674 WP_000719990.1.89679 WP_000719990.1.89700 WP_000719990.1.89710 WP_000719990.1.89747 WP_000719990.1.89768 WP_000719990.1.89781 WP_000719990.1.89788 WP_000719990.1.89818 WP_000719990.1.89839 WP_000719990.1.8985 WP_000719990.1.89852 WP_000719990.1.89859 WP_000719990.1.89879 WP_000719990.1.89895 WP_000719990.1.89899 WP_000719990.1.89915 WP_000719990.1.89917 WP_000719990.1.89918 WP_000719990.1.89920 WP_000719990.1.89923 WP_000719990.1.89927 WP_000719990.1.89959 WP_000719990.1.89977 WP_000719990.1.89988 WP_000719990.1.89998 WP_000719990.1.90050 WP_000719990.1.90063 WP_000719990.1.90065 WP_000719990.1.90078 WP_000719990.1.9009 WP_000719990.1.9010 WP_000719990.1.90115 WP_000719990.1.90128 WP_000719990.1.90139 WP_000719990.1.90146 WP_000719990.1.90156 WP_000719990.1.90168 WP_000719990.1.90171 WP_000719990.1.90182 WP_000719990.1.902 WP_000719990.1.90219 WP_000719990.1.90256 WP_000719990.1.90257 WP_000719990.1.90266 WP_000719990.1.90270 WP_000719990.1.90314 WP_000719990.1.90332 WP_000719990.1.90342 WP_000719990.1.90346 WP_000719990.1.90349 WP_000719990.1.90357 WP_000719990.1.90358 WP_000719990.1.9036 WP_000719990.1.9037 WP_000719990.1.90389 WP_000719990.1.90405 WP_000719990.1.90435 WP_000719990.1.90436 WP_000719990.1.90441 WP_000719990.1.90449 WP_000719990.1.90467 WP_000719990.1.90511 WP_000719990.1.90520 WP_000719990.1.90525 WP_000719990.1.90536 WP_000719990.1.90542 WP_000719990.1.9059 WP_000719990.1.90591 WP_000719990.1.90602 WP_000719990.1.9061 WP_000719990.1.90626 WP_000719990.1.90690 WP_000719990.1.90706 WP_000719990.1.90775 WP_000719990.1.90799 WP_000719990.1.9081 WP_000719990.1.90813 WP_000719990.1.90822 WP_000719990.1.90828 WP_000719990.1.90834 WP_000719990.1.90837 WP_000719990.1.90839 WP_000719990.1.90842 WP_000719990.1.90844 WP_000719990.1.90848 WP_000719990.1.90856 WP_000719990.1.90864 WP_000719990.1.90865 WP_000719990.1.9087 WP_000719990.1.90873 WP_000719990.1.90890 WP_000719990.1.909 WP_000719990.1.90905 WP_000719990.1.90924 WP_000719990.1.90951 WP_000719990.1.90960 WP_000719990.1.90967 WP_000719990.1.9098 WP_000719990.1.90988 WP_000719990.1.90996 WP_000719990.1.90997 WP_000719990.1.91 WP_000719990.1.91007 WP_000719990.1.91010 WP_000719990.1.91018 WP_000719990.1.9104 WP_000719990.1.91072 WP_000719990.1.91088 WP_000719990.1.91094 WP_000719990.1.91113 WP_000719990.1.91117 WP_000719990.1.91121 WP_000719990.1.91143 WP_000719990.1.91153 WP_000719990.1.91170 WP_000719990.1.9119 WP_000719990.1.91213 WP_000719990.1.91220 WP_000719990.1.91266 WP_000719990.1.91268 WP_000719990.1.91277 WP_000719990.1.91288 WP_000719990.1.91290 WP_000719990.1.91340 WP_000719990.1.91341 WP_000719990.1.91354 WP_000719990.1.91356 WP_000719990.1.91377 WP_000719990.1.91384 WP_000719990.1.91397 WP_000719990.1.91414 WP_000719990.1.91445 WP_000719990.1.91462 WP_000719990.1.91482 WP_000719990.1.91485 WP_000719990.1.915 WP_000719990.1.91511 WP_000719990.1.91515 WP_000719990.1.91548 WP_000719990.1.91551 WP_000719990.1.91565 WP_000719990.1.91566 WP_000719990.1.9157 WP_000719990.1.91594 WP_000719990.1.91596 WP_000719990.1.9160 WP_000719990.1.91626 WP_000719990.1.91640 WP_000719990.1.91643 WP_000719990.1.91651 WP_000719990.1.91666 WP_000719990.1.91672 WP_000719990.1.9168 WP_000719990.1.91685 WP_000719990.1.9169 WP_000719990.1.9171 WP_000719990.1.91739 WP_000719990.1.91756 WP_000719990.1.91779 WP_000719990.1.91782 WP_000719990.1.91787 WP_000719990.1.91801 WP_000719990.1.91814 WP_000719990.1.91843 WP_000719990.1.9185 WP_000719990.1.91850 WP_000719990.1.91863 WP_000719990.1.91871 WP_000719990.1.91879 WP_000719990.1.91887 WP_000719990.1.91893 WP_000719990.1.91951 WP_000719990.1.91954 WP_000719990.1.91959 WP_000719990.1.91965 WP_000719990.1.91971 WP_000719990.1.9199 WP_000719990.1.91994 WP_000719990.1.92014 WP_000719990.1.92019 WP_000719990.1.92025 WP_000719990.1.92031 WP_000719990.1.92048 WP_000719990.1.92053 WP_000719990.1.92058 WP_000719990.1.9209 WP_000719990.1.92096 WP_000719990.1.92102 WP_000719990.1.92114 WP_000719990.1.92123 WP_000719990.1.9215 WP_000719990.1.92161 WP_000719990.1.92163 WP_000719990.1.92180 WP_000719990.1.92201 WP_000719990.1.92215 WP_000719990.1.92224 WP_000719990.1.92276 WP_000719990.1.92295 WP_000719990.1.92304 WP_000719990.1.92305 WP_000719990.1.92311 WP_000719990.1.92323 WP_000719990.1.92384 WP_000719990.1.92403 WP_000719990.1.92434 WP_000719990.1.92473 WP_000719990.1.92496 WP_000719990.1.92532 WP_000719990.1.9255 WP_000719990.1.92568 WP_000719990.1.92577 WP_000719990.1.92614 WP_000719990.1.92615 WP_000719990.1.92634 WP_000719990.1.92638 WP_000719990.1.9264 WP_000719990.1.92648 WP_000719990.1.9266 WP_000719990.1.92668 WP_000719990.1.92693 WP_000719990.1.92708 WP_000719990.1.92719 WP_000719990.1.92742 WP_000719990.1.92750 WP_000719990.1.92767 WP_000719990.1.92780 WP_000719990.1.92781 WP_000719990.1.92792 WP_000719990.1.92819 WP_000719990.1.92845 WP_000719990.1.92865 WP_000719990.1.92943 WP_000719990.1.92953 WP_000719990.1.92989 WP_000719990.1.93005 WP_000719990.1.93016 WP_000719990.1.93017 WP_000719990.1.93019 WP_000719990.1.93027 WP_000719990.1.93033 WP_000719990.1.93048 WP_000719990.1.93054 WP_000719990.1.93069 WP_000719990.1.93072 WP_000719990.1.93085 WP_000719990.1.93100 WP_000719990.1.93112 WP_000719990.1.93133 WP_000719990.1.93138 WP_000719990.1.93139 WP_000719990.1.93150 WP_000719990.1.93167 WP_000719990.1.93175 WP_000719990.1.93185 WP_000719990.1.93233 WP_000719990.1.93252 WP_000719990.1.9327 WP_000719990.1.93276 WP_000719990.1.93291 WP_000719990.1.93309 WP_000719990.1.93312 WP_000719990.1.93326 WP_000719990.1.93338 WP_000719990.1.93379 WP_000719990.1.93388 WP_000719990.1.934 WP_000719990.1.93428 WP_000719990.1.93431 WP_000719990.1.93453 WP_000719990.1.93461 WP_000719990.1.93463 WP_000719990.1.93464 WP_000719990.1.93509 WP_000719990.1.93531 WP_000719990.1.93533 WP_000719990.1.93552 WP_000719990.1.9356 WP_000719990.1.93569 WP_000719990.1.93601 WP_000719990.1.93605 WP_000719990.1.93626 WP_000719990.1.93629 WP_000719990.1.93630 WP_000719990.1.93634 WP_000719990.1.93637 WP_000719990.1.93639 WP_000719990.1.93652 WP_000719990.1.93665 WP_000719990.1.93670 WP_000719990.1.93679 WP_000719990.1.93694 WP_000719990.1.93695 WP_000719990.1.93716 WP_000719990.1.93733 WP_000719990.1.93737 WP_000719990.1.93743 WP_000719990.1.93745 WP_000719990.1.93755 WP_000719990.1.93765 WP_000719990.1.93768 WP_000719990.1.93800 WP_000719990.1.93821 WP_000719990.1.93870 WP_000719990.1.93873 WP_000719990.1.93877 WP_000719990.1.93911 WP_000719990.1.93918 WP_000719990.1.93922 WP_000719990.1.93939 WP_000719990.1.93951 WP_000719990.1.93952 WP_000719990.1.93971 WP_000719990.1.94008 WP_000719990.1.94025 WP_000719990.1.94028 WP_000719990.1.94035 WP_000719990.1.94040 WP_000719990.1.94057 WP_000719990.1.94069 WP_000719990.1.9416 WP_000719990.1.94176 WP_000719990.1.94187 WP_000719990.1.94190 WP_000719990.1.9420 WP_000719990.1.94213 WP_000719990.1.94232 WP_000719990.1.9426 WP_000719990.1.94271 WP_000719990.1.94282 WP_000719990.1.94298 WP_000719990.1.94302 WP_000719990.1.94317 WP_000719990.1.94343 WP_000719990.1.94353 WP_000719990.1.94367 WP_000719990.1.94388 WP_000719990.1.94404 WP_000719990.1.94417 WP_000719990.1.94430 WP_000719990.1.94436 WP_000719990.1.94445 WP_000719990.1.94446 WP_000719990.1.94468 WP_000719990.1.94475 WP_000719990.1.94507 WP_000719990.1.94542 WP_000719990.1.94544 WP_000719990.1.94548 WP_000719990.1.9457 WP_000719990.1.94580 WP_000719990.1.94589 WP_000719990.1.94619 WP_000719990.1.94626 WP_000719990.1.94646 WP_000719990.1.94653 WP_000719990.1.94676 WP_000719990.1.94686 WP_000719990.1.94692 WP_000719990.1.94695 WP_000719990.1.94704 WP_000719990.1.94738 WP_000719990.1.94739 WP_000719990.1.9474 WP_000719990.1.94754 WP_000719990.1.94764 WP_000719990.1.94787 WP_000719990.1.94790 WP_000719990.1.948 WP_000719990.1.94806 WP_000719990.1.94808 WP_000719990.1.94822 WP_000719990.1.94836 WP_000719990.1.94847 WP_000719990.1.94869 WP_000719990.1.94880 WP_000719990.1.94889 WP_000719990.1.9489 WP_000719990.1.94892 WP_000719990.1.94898 WP_000719990.1.949 WP_000719990.1.94903 WP_000719990.1.9491 WP_000719990.1.94927 WP_000719990.1.94934 WP_000719990.1.94935 WP_000719990.1.94938 WP_000719990.1.94949 WP_000719990.1.94955 WP_000719990.1.94991 WP_000719990.1.94993 WP_000719990.1.94997 WP_000719990.1.95005 WP_000719990.1.95011 WP_000719990.1.95022 WP_000719990.1.95028 WP_000719990.1.95037 WP_000719990.1.95062 WP_000719990.1.95080 WP_000719990.1.95084 WP_000719990.1.95105 WP_000719990.1.95129 WP_000719990.1.9513 WP_000719990.1.95161 WP_000719990.1.95198 WP_000719990.1.95243 WP_000719990.1.95244 WP_000719990.1.95254 WP_000719990.1.95275 WP_000719990.1.95310 WP_000719990.1.95329 WP_000719990.1.95332 WP_000719990.1.95364 WP_000719990.1.95366 WP_000719990.1.95378 WP_000719990.1.95381 WP_000719990.1.95390 WP_000719990.1.95395 WP_000719990.1.95398 WP_000719990.1.95400 WP_000719990.1.95424 WP_000719990.1.95428 WP_000719990.1.95438 WP_000719990.1.95449 WP_000719990.1.95518 WP_000719990.1.95521 WP_000719990.1.95563 WP_000719990.1.9559 WP_000719990.1.95595 WP_000719990.1.95596 WP_000719990.1.95604 WP_000719990.1.95628 WP_000719990.1.95655 WP_000719990.1.9566 WP_000719990.1.95666 WP_000719990.1.95680 WP_000719990.1.95712 WP_000719990.1.95771 WP_000719990.1.95783 WP_000719990.1.95784 WP_000719990.1.95800 WP_000719990.1.95801 WP_000719990.1.95824 WP_000719990.1.95827 WP_000719990.1.95834 WP_000719990.1.95846 WP_000719990.1.95849 WP_000719990.1.95858 WP_000719990.1.95861 WP_000719990.1.95865 WP_000719990.1.95869 WP_000719990.1.95916 WP_000719990.1.95919 WP_000719990.1.95929 WP_000719990.1.95931 WP_000719990.1.95932 WP_000719990.1.95951 WP_000719990.1.96015 WP_000719990.1.96053 WP_000719990.1.96059 WP_000719990.1.96066 WP_000719990.1.96086 WP_000719990.1.96097 WP_000719990.1.96110 WP_000719990.1.96114 WP_000719990.1.96128 WP_000719990.1.96143 WP_000719990.1.96145 WP_000719990.1.9616 WP_000719990.1.96215 WP_000719990.1.96222 WP_000719990.1.96223 WP_000719990.1.96229 WP_000719990.1.96247 WP_000719990.1.96253 WP_000719990.1.96263 WP_000719990.1.96279 WP_000719990.1.96281 WP_000719990.1.96290 WP_000719990.1.96299 WP_000719990.1.96303 WP_000719990.1.9631 WP_000719990.1.96339 WP_000719990.1.96341 WP_000719990.1.96378 WP_000719990.1.96394 WP_000719990.1.9641 WP_000719990.1.96417 WP_000719990.1.96425 WP_000719990.1.96450 WP_000719990.1.96457 WP_000719990.1.96478 WP_000719990.1.96479 WP_000719990.1.96480 WP_000719990.1.96484 WP_000719990.1.9649 WP_000719990.1.96494 WP_000719990.1.965 WP_000719990.1.96519 WP_000719990.1.96541 WP_000719990.1.96558 WP_000719990.1.96562 WP_000719990.1.9657 WP_000719990.1.96585 WP_000719990.1.96608 WP_000719990.1.96609 WP_000719990.1.9661 WP_000719990.1.96617 WP_000719990.1.96633 WP_000719990.1.96650 WP_000719990.1.96659 WP_000719990.1.96676 WP_000719990.1.96680 WP_000719990.1.96695 WP_000719990.1.9671 WP_000719990.1.96725 WP_000719990.1.96743 WP_000719990.1.96759 WP_000719990.1.96762 WP_000719990.1.96769 WP_000719990.1.96796 WP_000719990.1.96797 WP_000719990.1.96817 WP_000719990.1.9682 WP_000719990.1.96850 WP_000719990.1.96864 WP_000719990.1.96894 WP_000719990.1.9690 WP_000719990.1.96907 WP_000719990.1.9691 WP_000719990.1.96924 WP_000719990.1.96932 WP_000719990.1.96936 WP_000719990.1.96944 WP_000719990.1.96971 WP_000719990.1.96984 WP_000719990.1.96989 WP_000719990.1.97011 WP_000719990.1.97049 WP_000719990.1.97059 WP_000719990.1.97119 WP_000719990.1.97123 WP_000719990.1.97147 WP_000719990.1.97170 WP_000719990.1.97193 WP_000719990.1.97200 WP_000719990.1.97226 WP_000719990.1.97231 WP_000719990.1.97238 WP_000719990.1.97247 WP_000719990.1.97248 WP_000719990.1.97269 WP_000719990.1.97279 WP_000719990.1.97282 WP_000719990.1.9729 WP_000719990.1.97292 WP_000719990.1.97344 WP_000719990.1.97351 WP_000719990.1.97356 WP_000719990.1.97360 WP_000719990.1.97361 WP_000719990.1.97379 WP_000719990.1.97387 WP_000719990.1.9740 WP_000719990.1.97402 WP_000719990.1.97418 WP_000719990.1.97421 WP_000719990.1.97434 WP_000719990.1.97437 WP_000719990.1.97439 WP_000719990.1.97459 WP_000719990.1.97464 WP_000719990.1.9747 WP_000719990.1.97502 WP_000719990.1.97513 WP_000719990.1.97525 WP_000719990.1.97544 WP_000719990.1.97549 WP_000719990.1.97560 WP_000719990.1.97571 WP_000719990.1.97619 WP_000719990.1.97632 WP_000719990.1.97654 WP_000719990.1.97667 WP_000719990.1.97685 WP_000719990.1.9770 WP_000719990.1.97705 WP_000719990.1.97770 WP_000719990.1.97778 WP_000719990.1.97789 WP_000719990.1.97798 WP_000719990.1.978 WP_000719990.1.97815 WP_000719990.1.97822 WP_000719990.1.97823 WP_000719990.1.97825 WP_000719990.1.97871 WP_000719990.1.97930 WP_000719990.1.97932 WP_000719990.1.97937 WP_000719990.1.97962 WP_000719990.1.97982 WP_000719990.1.97996 WP_000719990.1.98000 WP_000719990.1.98005 WP_000719990.1.98012 WP_000719990.1.98026 WP_000719990.1.9803 WP_000719990.1.98046 WP_000719990.1.98082 WP_000719990.1.98083 WP_000719990.1.981 WP_000719990.1.98102 WP_000719990.1.98115 WP_000719990.1.98139 WP_000719990.1.98155 WP_000719990.1.9816 WP_000719990.1.9817 WP_000719990.1.98176 WP_000719990.1.98187 WP_000719990.1.98202 WP_000719990.1.98205 WP_000719990.1.98220 WP_000719990.1.98232 WP_000719990.1.98235 WP_000719990.1.98239 WP_000719990.1.98241 WP_000719990.1.98244 WP_000719990.1.98251 WP_000719990.1.98279 WP_000719990.1.98292 WP_000719990.1.98294 WP_000719990.1.98301 WP_000719990.1.98312 WP_000719990.1.98323 WP_000719990.1.98357 WP_000719990.1.98384 WP_000719990.1.98400 WP_000719990.1.98404 WP_000719990.1.98424 WP_000719990.1.98429 WP_000719990.1.9844 WP_000719990.1.98442 WP_000719990.1.98451 WP_000719990.1.98466 WP_000719990.1.98477 WP_000719990.1.98480 WP_000719990.1.98484 WP_000719990.1.98543 WP_000719990.1.98549 WP_000719990.1.98578 WP_000719990.1.9858 WP_000719990.1.98614 WP_000719990.1.98626 WP_000719990.1.98628 WP_000719990.1.98633 WP_000719990.1.9864 WP_000719990.1.98654 WP_000719990.1.98665 WP_000719990.1.98668 WP_000719990.1.98683 WP_000719990.1.98727 WP_000719990.1.98757 WP_000719990.1.98775 WP_000719990.1.98776 WP_000719990.1.98784 WP_000719990.1.98795 WP_000719990.1.9883 WP_000719990.1.98875 WP_000719990.1.98920 WP_000719990.1.98976 WP_000719990.1.98988 WP_000719990.1.99006 WP_000719990.1.99029 WP_000719990.1.99046 WP_000719990.1.99060 WP_000719990.1.99101 WP_000719990.1.99119 WP_000719990.1.99168 WP_000719990.1.99182 WP_000719990.1.99209 WP_000719990.1.99234 WP_000719990.1.99246 WP_000719990.1.99265 WP_000719990.1.99292 WP_000719990.1.99295 WP_000719990.1.9930 WP_000719990.1.99302 WP_000719990.1.99304 WP_000719990.1.99306 WP_000719990.1.99307 WP_000719990.1.99310 WP_000719990.1.99319 WP_000719990.1.99345 WP_000719990.1.99349 WP_000719990.1.9935 WP_000719990.1.99361 WP_000719990.1.99366 WP_000719990.1.99392 WP_000719990.1.9940 WP_000719990.1.99400 WP_000719990.1.99401 WP_000719990.1.99453 WP_000719990.1.99458 WP_000719990.1.99471 WP_000719990.1.99472 WP_000719990.1.99475 WP_000719990.1.99486 WP_000719990.1.99487 WP_000719990.1.99498 WP_000719990.1.9950 WP_000719990.1.99501 WP_000719990.1.99511 WP_000719990.1.99534 WP_000719990.1.99549 WP_000719990.1.99562 WP_000719990.1.99571 WP_000719990.1.99592 WP_000719990.1.99602 WP_000719990.1.99603 WP_000719990.1.99619 WP_000719990.1.99632 WP_000719990.1.99666 WP_000719990.1.99692 WP_000719990.1.99694 WP_000719990.1.99698 WP_000719990.1.99734 WP_000719990.1.99771 WP_000719990.1.99782 WP_000719990.1.99804 WP_000719990.1.99827 WP_000719990.1.99869 WP_000719990.1.99874 WP_000719990.1.99891 WP_000719990.1.99892 WP_000719990.1.99929 WP_000719990.1.99986 YP_002409517.1.10275 YP_006121440.1.29421 YP_006777405.1.12065 gi|170680786|ref|YP_001745387.1| gi|251786387|ref|YP_003000691.1| gi|387613805|ref|YP_006116921.1| gi|386640724|ref|YP_006107522.1| gi|218696819|ref|YP_002404486.1| gi|471334678|ref|YP_007558155.1| gi|254795062|ref|YP_003079899.1| gi|260845927|ref|YP_003223705.1| gi|386711018|ref|YP_006174739.1| gi|386601148|ref|YP_006102654.1| gi|170018634|ref|YP_001723588.1| gi|378711430|ref|YP_005276323.1| gi|222157834|ref|YP_002557973.1| gi|30064456|ref|NP_838627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]