SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386622013|ref|YP_006141593.1| from Escherichia coli NA114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386622013|ref|YP_006141593.1|
Domain Number 1 Region: 7-129
Classification Level Classification E-value
Superfamily YjgF-like 1.19e-35
Family YjgF/L-PSP 0.000000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386622013|ref|YP_006141593.1|
Sequence length 131
Comment Putative endoribonuclease L-PSP family [Escherichia coli NA114]
Sequence
MVERTAVFPAGRHSLYAEHRYSAAIRSGDLLFVSGQVGSREDGTPEPDFQQQVRLAFDNL
HATLAAAGCTFDDIIDVTSFHTDPEKQFEDIMTVKNEIFSAPPYPNWTAVGVTWLAGFDF
EIKVIARIPEL
Download sequence
Identical sequences A0A028AR10 A0A028E6S3 A0A066SYY1 A0A0G3KAX2 A0A125WV48 A0A192CFV3 A0A1S9JK91 A0A1X3L8J7 B1LRD4 D3GW46 D6J5M1 F5MW68 F5P3X7 G0F7S9 H4USW1 I2X9R6 I6B6E8 I6F8L6 K4XPK6 L3QGK3 L4JJ71 W8ZSS0
WP_000230273.1.100014 WP_000230273.1.100281 WP_000230273.1.100304 WP_000230273.1.100444 WP_000230273.1.100496 WP_000230273.1.100718 WP_000230273.1.101087 WP_000230273.1.101110 WP_000230273.1.101157 WP_000230273.1.101158 WP_000230273.1.101216 WP_000230273.1.101282 WP_000230273.1.101399 WP_000230273.1.101653 WP_000230273.1.101654 WP_000230273.1.101668 WP_000230273.1.101727 WP_000230273.1.101737 WP_000230273.1.101840 WP_000230273.1.101855 WP_000230273.1.101913 WP_000230273.1.101932 WP_000230273.1.102069 WP_000230273.1.102104 WP_000230273.1.10226 WP_000230273.1.10252 WP_000230273.1.10381 WP_000230273.1.10461 WP_000230273.1.10538 WP_000230273.1.10573 WP_000230273.1.10579 WP_000230273.1.10607 WP_000230273.1.10763 WP_000230273.1.10833 WP_000230273.1.10842 WP_000230273.1.10849 WP_000230273.1.11118 WP_000230273.1.112 WP_000230273.1.11315 WP_000230273.1.11467 WP_000230273.1.11607 WP_000230273.1.11612 WP_000230273.1.1168 WP_000230273.1.11759 WP_000230273.1.11949 WP_000230273.1.11981 WP_000230273.1.11982 WP_000230273.1.12115 WP_000230273.1.1212 WP_000230273.1.12151 WP_000230273.1.12230 WP_000230273.1.12645 WP_000230273.1.12679 WP_000230273.1.127 WP_000230273.1.12749 WP_000230273.1.12756 WP_000230273.1.12914 WP_000230273.1.12956 WP_000230273.1.12976 WP_000230273.1.12991 WP_000230273.1.13031 WP_000230273.1.13117 WP_000230273.1.13136 WP_000230273.1.13176 WP_000230273.1.13222 WP_000230273.1.13239 WP_000230273.1.13333 WP_000230273.1.13934 WP_000230273.1.14058 WP_000230273.1.14506 WP_000230273.1.14581 WP_000230273.1.14693 WP_000230273.1.14746 WP_000230273.1.14811 WP_000230273.1.14833 WP_000230273.1.1512 WP_000230273.1.1524 WP_000230273.1.15259 WP_000230273.1.15645 WP_000230273.1.15654 WP_000230273.1.15863 WP_000230273.1.1588 WP_000230273.1.15916 WP_000230273.1.1604 WP_000230273.1.16067 WP_000230273.1.16086 WP_000230273.1.16322 WP_000230273.1.16396 WP_000230273.1.1640 WP_000230273.1.16517 WP_000230273.1.16577 WP_000230273.1.16700 WP_000230273.1.16807 WP_000230273.1.17014 WP_000230273.1.17018 WP_000230273.1.17170 WP_000230273.1.17206 WP_000230273.1.17333 WP_000230273.1.17464 WP_000230273.1.17577 WP_000230273.1.17637 WP_000230273.1.17680 WP_000230273.1.17769 WP_000230273.1.17920 WP_000230273.1.17925 WP_000230273.1.18006 WP_000230273.1.18024 WP_000230273.1.18050 WP_000230273.1.18118 WP_000230273.1.18229 WP_000230273.1.18316 WP_000230273.1.18348 WP_000230273.1.18394 WP_000230273.1.18402 WP_000230273.1.18438 WP_000230273.1.18458 WP_000230273.1.18556 WP_000230273.1.18588 WP_000230273.1.18651 WP_000230273.1.18734 WP_000230273.1.18858 WP_000230273.1.1906 WP_000230273.1.19150 WP_000230273.1.19277 WP_000230273.1.19313 WP_000230273.1.19379 WP_000230273.1.19547 WP_000230273.1.19583 WP_000230273.1.19593 WP_000230273.1.19830 WP_000230273.1.19940 WP_000230273.1.19957 WP_000230273.1.20133 WP_000230273.1.20136 WP_000230273.1.20238 WP_000230273.1.20334 WP_000230273.1.20388 WP_000230273.1.20536 WP_000230273.1.20741 WP_000230273.1.20863 WP_000230273.1.21029 WP_000230273.1.21152 WP_000230273.1.21266 WP_000230273.1.21378 WP_000230273.1.21455 WP_000230273.1.21537 WP_000230273.1.21667 WP_000230273.1.21732 WP_000230273.1.21823 WP_000230273.1.22021 WP_000230273.1.22161 WP_000230273.1.22195 WP_000230273.1.22203 WP_000230273.1.22272 WP_000230273.1.22280 WP_000230273.1.22328 WP_000230273.1.2242 WP_000230273.1.22450 WP_000230273.1.22464 WP_000230273.1.22544 WP_000230273.1.22549 WP_000230273.1.22576 WP_000230273.1.22632 WP_000230273.1.22649 WP_000230273.1.22669 WP_000230273.1.22691 WP_000230273.1.22824 WP_000230273.1.22917 WP_000230273.1.22993 WP_000230273.1.23109 WP_000230273.1.23330 WP_000230273.1.23351 WP_000230273.1.23522 WP_000230273.1.23593 WP_000230273.1.23693 WP_000230273.1.23724 WP_000230273.1.23741 WP_000230273.1.23754 WP_000230273.1.23804 WP_000230273.1.23840 WP_000230273.1.23890 WP_000230273.1.23945 WP_000230273.1.23960 WP_000230273.1.23985 WP_000230273.1.24088 WP_000230273.1.24124 WP_000230273.1.24127 WP_000230273.1.24460 WP_000230273.1.2449 WP_000230273.1.24499 WP_000230273.1.24523 WP_000230273.1.24583 WP_000230273.1.24646 WP_000230273.1.2469 WP_000230273.1.24703 WP_000230273.1.24773 WP_000230273.1.24808 WP_000230273.1.24906 WP_000230273.1.24960 WP_000230273.1.24979 WP_000230273.1.25019 WP_000230273.1.25079 WP_000230273.1.25380 WP_000230273.1.25446 WP_000230273.1.25480 WP_000230273.1.25592 WP_000230273.1.25613 WP_000230273.1.2567 WP_000230273.1.25701 WP_000230273.1.25713 WP_000230273.1.25724 WP_000230273.1.25869 WP_000230273.1.25873 WP_000230273.1.25886 WP_000230273.1.25895 WP_000230273.1.2597 WP_000230273.1.26048 WP_000230273.1.26186 WP_000230273.1.26189 WP_000230273.1.26264 WP_000230273.1.26304 WP_000230273.1.26403 WP_000230273.1.26419 WP_000230273.1.26480 WP_000230273.1.26720 WP_000230273.1.26950 WP_000230273.1.26987 WP_000230273.1.26995 WP_000230273.1.27134 WP_000230273.1.27148 WP_000230273.1.27188 WP_000230273.1.2731 WP_000230273.1.27313 WP_000230273.1.27401 WP_000230273.1.27504 WP_000230273.1.27560 WP_000230273.1.27611 WP_000230273.1.27693 WP_000230273.1.27897 WP_000230273.1.27913 WP_000230273.1.27998 WP_000230273.1.28128 WP_000230273.1.28156 WP_000230273.1.28271 WP_000230273.1.28314 WP_000230273.1.28349 WP_000230273.1.28742 WP_000230273.1.2881 WP_000230273.1.28842 WP_000230273.1.28950 WP_000230273.1.28994 WP_000230273.1.29026 WP_000230273.1.29164 WP_000230273.1.29202 WP_000230273.1.29504 WP_000230273.1.29603 WP_000230273.1.29798 WP_000230273.1.29821 WP_000230273.1.29876 WP_000230273.1.30035 WP_000230273.1.30063 WP_000230273.1.3018 WP_000230273.1.30232 WP_000230273.1.30239 WP_000230273.1.30497 WP_000230273.1.30554 WP_000230273.1.30665 WP_000230273.1.30749 WP_000230273.1.30867 WP_000230273.1.30879 WP_000230273.1.31017 WP_000230273.1.31357 WP_000230273.1.31379 WP_000230273.1.31422 WP_000230273.1.31429 WP_000230273.1.3147 WP_000230273.1.31511 WP_000230273.1.31518 WP_000230273.1.31557 WP_000230273.1.31833 WP_000230273.1.31898 WP_000230273.1.32021 WP_000230273.1.32142 WP_000230273.1.32394 WP_000230273.1.32432 WP_000230273.1.3247 WP_000230273.1.32475 WP_000230273.1.3259 WP_000230273.1.32591 WP_000230273.1.3269 WP_000230273.1.32831 WP_000230273.1.32903 WP_000230273.1.32995 WP_000230273.1.33303 WP_000230273.1.334 WP_000230273.1.3344 WP_000230273.1.33565 WP_000230273.1.33854 WP_000230273.1.3401 WP_000230273.1.34121 WP_000230273.1.34456 WP_000230273.1.34470 WP_000230273.1.34525 WP_000230273.1.3460 WP_000230273.1.34875 WP_000230273.1.34887 WP_000230273.1.34931 WP_000230273.1.34990 WP_000230273.1.34993 WP_000230273.1.35003 WP_000230273.1.35007 WP_000230273.1.35127 WP_000230273.1.35220 WP_000230273.1.35698 WP_000230273.1.35789 WP_000230273.1.35987 WP_000230273.1.36164 WP_000230273.1.36177 WP_000230273.1.36332 WP_000230273.1.36405 WP_000230273.1.3643 WP_000230273.1.36724 WP_000230273.1.36761 WP_000230273.1.36904 WP_000230273.1.3697 WP_000230273.1.37046 WP_000230273.1.37233 WP_000230273.1.37306 WP_000230273.1.37342 WP_000230273.1.37544 WP_000230273.1.37550 WP_000230273.1.3772 WP_000230273.1.37817 WP_000230273.1.37830 WP_000230273.1.37880 WP_000230273.1.37917 WP_000230273.1.37998 WP_000230273.1.38000 WP_000230273.1.3811 WP_000230273.1.38185 WP_000230273.1.38300 WP_000230273.1.38561 WP_000230273.1.38843 WP_000230273.1.38920 WP_000230273.1.38956 WP_000230273.1.39005 WP_000230273.1.39103 WP_000230273.1.39148 WP_000230273.1.39286 WP_000230273.1.39289 WP_000230273.1.39313 WP_000230273.1.39356 WP_000230273.1.39401 WP_000230273.1.39430 WP_000230273.1.39606 WP_000230273.1.39713 WP_000230273.1.39809 WP_000230273.1.39829 WP_000230273.1.39867 WP_000230273.1.39870 WP_000230273.1.39970 WP_000230273.1.40 WP_000230273.1.40016 WP_000230273.1.40107 WP_000230273.1.40206 WP_000230273.1.40211 WP_000230273.1.40218 WP_000230273.1.40249 WP_000230273.1.40300 WP_000230273.1.40345 WP_000230273.1.40560 WP_000230273.1.40636 WP_000230273.1.40657 WP_000230273.1.40660 WP_000230273.1.40715 WP_000230273.1.40842 WP_000230273.1.40898 WP_000230273.1.40912 WP_000230273.1.41372 WP_000230273.1.41392 WP_000230273.1.41407 WP_000230273.1.41453 WP_000230273.1.41455 WP_000230273.1.41482 WP_000230273.1.41539 WP_000230273.1.41556 WP_000230273.1.41741 WP_000230273.1.41813 WP_000230273.1.41885 WP_000230273.1.41900 WP_000230273.1.41991 WP_000230273.1.42022 WP_000230273.1.42038 WP_000230273.1.42138 WP_000230273.1.42151 WP_000230273.1.42203 WP_000230273.1.42387 WP_000230273.1.42442 WP_000230273.1.42448 WP_000230273.1.42516 WP_000230273.1.42601 WP_000230273.1.42638 WP_000230273.1.4290 WP_000230273.1.42936 WP_000230273.1.4306 WP_000230273.1.43216 WP_000230273.1.43270 WP_000230273.1.43278 WP_000230273.1.43316 WP_000230273.1.4342 WP_000230273.1.43422 WP_000230273.1.4343 WP_000230273.1.44018 WP_000230273.1.44077 WP_000230273.1.44096 WP_000230273.1.44166 WP_000230273.1.44201 WP_000230273.1.44263 WP_000230273.1.44354 WP_000230273.1.44460 WP_000230273.1.44784 WP_000230273.1.44849 WP_000230273.1.44970 WP_000230273.1.44975 WP_000230273.1.44980 WP_000230273.1.45000 WP_000230273.1.45405 WP_000230273.1.45440 WP_000230273.1.45565 WP_000230273.1.45595 WP_000230273.1.45627 WP_000230273.1.45676 WP_000230273.1.4574 WP_000230273.1.4576 WP_000230273.1.45806 WP_000230273.1.45868 WP_000230273.1.45960 WP_000230273.1.46105 WP_000230273.1.46115 WP_000230273.1.46122 WP_000230273.1.46164 WP_000230273.1.46186 WP_000230273.1.46291 WP_000230273.1.46582 WP_000230273.1.46668 WP_000230273.1.46806 WP_000230273.1.46994 WP_000230273.1.47038 WP_000230273.1.4725 WP_000230273.1.47414 WP_000230273.1.47464 WP_000230273.1.47473 WP_000230273.1.47662 WP_000230273.1.4772 WP_000230273.1.47740 WP_000230273.1.47765 WP_000230273.1.4783 WP_000230273.1.47935 WP_000230273.1.48029 WP_000230273.1.48051 WP_000230273.1.48096 WP_000230273.1.48121 WP_000230273.1.48194 WP_000230273.1.48317 WP_000230273.1.48353 WP_000230273.1.48469 WP_000230273.1.48571 WP_000230273.1.48620 WP_000230273.1.4876 WP_000230273.1.48953 WP_000230273.1.49009 WP_000230273.1.49061 WP_000230273.1.49258 WP_000230273.1.49347 WP_000230273.1.49537 WP_000230273.1.49594 WP_000230273.1.49615 WP_000230273.1.49621 WP_000230273.1.49625 WP_000230273.1.49645 WP_000230273.1.49661 WP_000230273.1.497 WP_000230273.1.49712 WP_000230273.1.49733 WP_000230273.1.49823 WP_000230273.1.49884 WP_000230273.1.49900 WP_000230273.1.49972 WP_000230273.1.50008 WP_000230273.1.50058 WP_000230273.1.50119 WP_000230273.1.50179 WP_000230273.1.50427 WP_000230273.1.50585 WP_000230273.1.50690 WP_000230273.1.50947 WP_000230273.1.50988 WP_000230273.1.50990 WP_000230273.1.51042 WP_000230273.1.51172 WP_000230273.1.51175 WP_000230273.1.51180 WP_000230273.1.51190 WP_000230273.1.51211 WP_000230273.1.5124 WP_000230273.1.51260 WP_000230273.1.51299 WP_000230273.1.51325 WP_000230273.1.51330 WP_000230273.1.51392 WP_000230273.1.51495 WP_000230273.1.51537 WP_000230273.1.51548 WP_000230273.1.51596 WP_000230273.1.51600 WP_000230273.1.51690 WP_000230273.1.51784 WP_000230273.1.51949 WP_000230273.1.51979 WP_000230273.1.52048 WP_000230273.1.52098 WP_000230273.1.52135 WP_000230273.1.52214 WP_000230273.1.52270 WP_000230273.1.52272 WP_000230273.1.52305 WP_000230273.1.52492 WP_000230273.1.52774 WP_000230273.1.52777 WP_000230273.1.53251 WP_000230273.1.53537 WP_000230273.1.53769 WP_000230273.1.5391 WP_000230273.1.54032 WP_000230273.1.54091 WP_000230273.1.54095 WP_000230273.1.54328 WP_000230273.1.54418 WP_000230273.1.54429 WP_000230273.1.54439 WP_000230273.1.54620 WP_000230273.1.54643 WP_000230273.1.54695 WP_000230273.1.5470 WP_000230273.1.54755 WP_000230273.1.54875 WP_000230273.1.54993 WP_000230273.1.55123 WP_000230273.1.55149 WP_000230273.1.55529 WP_000230273.1.55551 WP_000230273.1.55556 WP_000230273.1.55563 WP_000230273.1.55868 WP_000230273.1.55981 WP_000230273.1.55988 WP_000230273.1.56033 WP_000230273.1.56139 WP_000230273.1.56164 WP_000230273.1.56197 WP_000230273.1.56278 WP_000230273.1.5632 WP_000230273.1.56338 WP_000230273.1.56402 WP_000230273.1.56457 WP_000230273.1.5646 WP_000230273.1.56502 WP_000230273.1.5670 WP_000230273.1.56830 WP_000230273.1.56835 WP_000230273.1.56933 WP_000230273.1.56936 WP_000230273.1.57124 WP_000230273.1.57181 WP_000230273.1.57266 WP_000230273.1.57395 WP_000230273.1.57410 WP_000230273.1.57432 WP_000230273.1.57438 WP_000230273.1.57451 WP_000230273.1.58022 WP_000230273.1.58094 WP_000230273.1.5810 WP_000230273.1.58248 WP_000230273.1.58401 WP_000230273.1.58459 WP_000230273.1.58475 WP_000230273.1.58552 WP_000230273.1.58609 WP_000230273.1.58617 WP_000230273.1.58657 WP_000230273.1.59055 WP_000230273.1.59073 WP_000230273.1.5942 WP_000230273.1.59426 WP_000230273.1.59572 WP_000230273.1.59613 WP_000230273.1.59660 WP_000230273.1.59745 WP_000230273.1.60133 WP_000230273.1.60235 WP_000230273.1.60373 WP_000230273.1.60411 WP_000230273.1.60544 WP_000230273.1.6059 WP_000230273.1.60591 WP_000230273.1.6061 WP_000230273.1.60835 WP_000230273.1.60901 WP_000230273.1.6110 WP_000230273.1.61112 WP_000230273.1.61245 WP_000230273.1.61442 WP_000230273.1.61445 WP_000230273.1.61770 WP_000230273.1.61957 WP_000230273.1.62102 WP_000230273.1.62296 WP_000230273.1.62454 WP_000230273.1.62514 WP_000230273.1.62529 WP_000230273.1.62541 WP_000230273.1.62668 WP_000230273.1.62788 WP_000230273.1.62851 WP_000230273.1.62919 WP_000230273.1.62989 WP_000230273.1.6299 WP_000230273.1.6307 WP_000230273.1.6323 WP_000230273.1.63437 WP_000230273.1.63487 WP_000230273.1.63604 WP_000230273.1.63814 WP_000230273.1.64040 WP_000230273.1.64045 WP_000230273.1.64050 WP_000230273.1.64053 WP_000230273.1.64074 WP_000230273.1.64165 WP_000230273.1.64285 WP_000230273.1.64353 WP_000230273.1.64356 WP_000230273.1.64417 WP_000230273.1.647 WP_000230273.1.64712 WP_000230273.1.65061 WP_000230273.1.65114 WP_000230273.1.65286 WP_000230273.1.65353 WP_000230273.1.65366 WP_000230273.1.65456 WP_000230273.1.65606 WP_000230273.1.65961 WP_000230273.1.65962 WP_000230273.1.66017 WP_000230273.1.66022 WP_000230273.1.6618 WP_000230273.1.66288 WP_000230273.1.6635 WP_000230273.1.66389 WP_000230273.1.66395 WP_000230273.1.66501 WP_000230273.1.66550 WP_000230273.1.66624 WP_000230273.1.66700 WP_000230273.1.66719 WP_000230273.1.6698 WP_000230273.1.66984 WP_000230273.1.67018 WP_000230273.1.67021 WP_000230273.1.67022 WP_000230273.1.67102 WP_000230273.1.67153 WP_000230273.1.67174 WP_000230273.1.67258 WP_000230273.1.67272 WP_000230273.1.67427 WP_000230273.1.67454 WP_000230273.1.67464 WP_000230273.1.67606 WP_000230273.1.67681 WP_000230273.1.67685 WP_000230273.1.67737 WP_000230273.1.67802 WP_000230273.1.67861 WP_000230273.1.67971 WP_000230273.1.67992 WP_000230273.1.68025 WP_000230273.1.68170 WP_000230273.1.68215 WP_000230273.1.68300 WP_000230273.1.68341 WP_000230273.1.68362 WP_000230273.1.68396 WP_000230273.1.68524 WP_000230273.1.68572 WP_000230273.1.6860 WP_000230273.1.68697 WP_000230273.1.68793 WP_000230273.1.68795 WP_000230273.1.68847 WP_000230273.1.68911 WP_000230273.1.68995 WP_000230273.1.69033 WP_000230273.1.69160 WP_000230273.1.69341 WP_000230273.1.69589 WP_000230273.1.7001 WP_000230273.1.70794 WP_000230273.1.70801 WP_000230273.1.70880 WP_000230273.1.70896 WP_000230273.1.7090 WP_000230273.1.71024 WP_000230273.1.71134 WP_000230273.1.71139 WP_000230273.1.71144 WP_000230273.1.71147 WP_000230273.1.71183 WP_000230273.1.71275 WP_000230273.1.71311 WP_000230273.1.71323 WP_000230273.1.71563 WP_000230273.1.71837 WP_000230273.1.71855 WP_000230273.1.71944 WP_000230273.1.7205 WP_000230273.1.72162 WP_000230273.1.72186 WP_000230273.1.72212 WP_000230273.1.72316 WP_000230273.1.72337 WP_000230273.1.72359 WP_000230273.1.72388 WP_000230273.1.72537 WP_000230273.1.72619 WP_000230273.1.72700 WP_000230273.1.72747 WP_000230273.1.7277 WP_000230273.1.7281 WP_000230273.1.72858 WP_000230273.1.73032 WP_000230273.1.73039 WP_000230273.1.7307 WP_000230273.1.73085 WP_000230273.1.7309 WP_000230273.1.73094 WP_000230273.1.73215 WP_000230273.1.73291 WP_000230273.1.73344 WP_000230273.1.73385 WP_000230273.1.73430 WP_000230273.1.73486 WP_000230273.1.73700 WP_000230273.1.73709 WP_000230273.1.73717 WP_000230273.1.73797 WP_000230273.1.73835 WP_000230273.1.73942 WP_000230273.1.74123 WP_000230273.1.74309 WP_000230273.1.74365 WP_000230273.1.74426 WP_000230273.1.74431 WP_000230273.1.74528 WP_000230273.1.74549 WP_000230273.1.74574 WP_000230273.1.74752 WP_000230273.1.74765 WP_000230273.1.7516 WP_000230273.1.75419 WP_000230273.1.75491 WP_000230273.1.75537 WP_000230273.1.75588 WP_000230273.1.75612 WP_000230273.1.75644 WP_000230273.1.75679 WP_000230273.1.75853 WP_000230273.1.75995 WP_000230273.1.76030 WP_000230273.1.7613 WP_000230273.1.7617 WP_000230273.1.76211 WP_000230273.1.76446 WP_000230273.1.76542 WP_000230273.1.76933 WP_000230273.1.76948 WP_000230273.1.77022 WP_000230273.1.77042 WP_000230273.1.771 WP_000230273.1.77109 WP_000230273.1.77200 WP_000230273.1.77224 WP_000230273.1.77284 WP_000230273.1.77455 WP_000230273.1.77503 WP_000230273.1.77595 WP_000230273.1.77813 WP_000230273.1.78000 WP_000230273.1.78010 WP_000230273.1.7804 WP_000230273.1.78233 WP_000230273.1.78305 WP_000230273.1.78321 WP_000230273.1.78368 WP_000230273.1.7847 WP_000230273.1.78491 WP_000230273.1.78527 WP_000230273.1.78575 WP_000230273.1.78612 WP_000230273.1.78698 WP_000230273.1.78718 WP_000230273.1.78757 WP_000230273.1.78814 WP_000230273.1.78908 WP_000230273.1.78955 WP_000230273.1.79086 WP_000230273.1.79243 WP_000230273.1.79306 WP_000230273.1.79356 WP_000230273.1.79414 WP_000230273.1.79558 WP_000230273.1.79606 WP_000230273.1.79619 WP_000230273.1.7987 WP_000230273.1.79877 WP_000230273.1.79973 WP_000230273.1.79995 WP_000230273.1.80 WP_000230273.1.80026 WP_000230273.1.80061 WP_000230273.1.8007 WP_000230273.1.80096 WP_000230273.1.8011 WP_000230273.1.80320 WP_000230273.1.80392 WP_000230273.1.80428 WP_000230273.1.80440 WP_000230273.1.8057 WP_000230273.1.80577 WP_000230273.1.81032 WP_000230273.1.81034 WP_000230273.1.81056 WP_000230273.1.81141 WP_000230273.1.81313 WP_000230273.1.81475 WP_000230273.1.81577 WP_000230273.1.81582 WP_000230273.1.81588 WP_000230273.1.81715 WP_000230273.1.81956 WP_000230273.1.82106 WP_000230273.1.82217 WP_000230273.1.82242 WP_000230273.1.8255 WP_000230273.1.82647 WP_000230273.1.82691 WP_000230273.1.82715 WP_000230273.1.82747 WP_000230273.1.82816 WP_000230273.1.82833 WP_000230273.1.8295 WP_000230273.1.82991 WP_000230273.1.83020 WP_000230273.1.83059 WP_000230273.1.8308 WP_000230273.1.83118 WP_000230273.1.83151 WP_000230273.1.83205 WP_000230273.1.83224 WP_000230273.1.83537 WP_000230273.1.83735 WP_000230273.1.83879 WP_000230273.1.83936 WP_000230273.1.8411 WP_000230273.1.84215 WP_000230273.1.84313 WP_000230273.1.84326 WP_000230273.1.84331 WP_000230273.1.8444 WP_000230273.1.84464 WP_000230273.1.84467 WP_000230273.1.8447 WP_000230273.1.84531 WP_000230273.1.84584 WP_000230273.1.84639 WP_000230273.1.84740 WP_000230273.1.84784 WP_000230273.1.84877 WP_000230273.1.84893 WP_000230273.1.84894 WP_000230273.1.84941 WP_000230273.1.84989 WP_000230273.1.84990 WP_000230273.1.85002 WP_000230273.1.85138 WP_000230273.1.85216 WP_000230273.1.85255 WP_000230273.1.85329 WP_000230273.1.85623 WP_000230273.1.85762 WP_000230273.1.85773 WP_000230273.1.85806 WP_000230273.1.85944 WP_000230273.1.85948 WP_000230273.1.8621 WP_000230273.1.86227 WP_000230273.1.86228 WP_000230273.1.86412 WP_000230273.1.86673 WP_000230273.1.86691 WP_000230273.1.86727 WP_000230273.1.86768 WP_000230273.1.86997 WP_000230273.1.87043 WP_000230273.1.87147 WP_000230273.1.87371 WP_000230273.1.8778 WP_000230273.1.8822 WP_000230273.1.88260 WP_000230273.1.88263 WP_000230273.1.88336 WP_000230273.1.8848 WP_000230273.1.88499 WP_000230273.1.8855 WP_000230273.1.88631 WP_000230273.1.88752 WP_000230273.1.88880 WP_000230273.1.89203 WP_000230273.1.89468 WP_000230273.1.89630 WP_000230273.1.8985 WP_000230273.1.89879 WP_000230273.1.89917 WP_000230273.1.89977 WP_000230273.1.90017 WP_000230273.1.90050 WP_000230273.1.90078 WP_000230273.1.90128 WP_000230273.1.90358 WP_000230273.1.9036 WP_000230273.1.90525 WP_000230273.1.90703 WP_000230273.1.90706 WP_000230273.1.90856 WP_000230273.1.909 WP_000230273.1.90951 WP_000230273.1.90988 WP_000230273.1.91 WP_000230273.1.91143 WP_000230273.1.91266 WP_000230273.1.91354 WP_000230273.1.91462 WP_000230273.1.91485 WP_000230273.1.91551 WP_000230273.1.91782 WP_000230273.1.9199 WP_000230273.1.9215 WP_000230273.1.92295 WP_000230273.1.92305 WP_000230273.1.92384 WP_000230273.1.92615 WP_000230273.1.92638 WP_000230273.1.92742 WP_000230273.1.92750 WP_000230273.1.92780 WP_000230273.1.92845 WP_000230273.1.92943 WP_000230273.1.93017 WP_000230273.1.93054 WP_000230273.1.93138 WP_000230273.1.93464 WP_000230273.1.93533 WP_000230273.1.93621 WP_000230273.1.93652 WP_000230273.1.93737 WP_000230273.1.93922 WP_000230273.1.94028 WP_000230273.1.94190 WP_000230273.1.94271 WP_000230273.1.94298 WP_000230273.1.94353 WP_000230273.1.94388 WP_000230273.1.94417 WP_000230273.1.94468 WP_000230273.1.94653 WP_000230273.1.9489 WP_000230273.1.94892 WP_000230273.1.94927 WP_000230273.1.94997 WP_000230273.1.95105 WP_000230273.1.9513 WP_000230273.1.95329 WP_000230273.1.95366 WP_000230273.1.95378 WP_000230273.1.95655 WP_000230273.1.9566 WP_000230273.1.95666 WP_000230273.1.95680 WP_000230273.1.95783 WP_000230273.1.95801 WP_000230273.1.95827 WP_000230273.1.95849 WP_000230273.1.96015 WP_000230273.1.96145 WP_000230273.1.96215 WP_000230273.1.96223 WP_000230273.1.96281 WP_000230273.1.96299 WP_000230273.1.96457 WP_000230273.1.96478 WP_000230273.1.96633 WP_000230273.1.96676 WP_000230273.1.9671 WP_000230273.1.96924 WP_000230273.1.96971 WP_000230273.1.97170 WP_000230273.1.9723 WP_000230273.1.97544 WP_000230273.1.97560 WP_000230273.1.97654 WP_000230273.1.97798 WP_000230273.1.98005 WP_000230273.1.98012 WP_000230273.1.98232 WP_000230273.1.98235 WP_000230273.1.98294 WP_000230273.1.98301 WP_000230273.1.98355 WP_000230273.1.98424 WP_000230273.1.9858 WP_000230273.1.98633 WP_000230273.1.98776 WP_000230273.1.99289 WP_000230273.1.99307 WP_000230273.1.99319 WP_000230273.1.99334 WP_000230273.1.9935 WP_000230273.1.99366 WP_000230273.1.99400 WP_000230273.1.99498 WP_000230273.1.99562 WP_000230273.1.99602 WP_000230273.1.99632 WP_000230273.1.99734 gi|386622013|ref|YP_006141593.1| 439855.EcSMS35_4728 573235.ECO26_5418 gi|387610120|ref|YP_006098976.1| gi|170679593|ref|YP_001746652.1| gi|556554061|ref|YP_008724653.1| gi|260858402|ref|YP_003232293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]