SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387505162|ref|YP_006157418.1| from Escherichia coli O55:H7 str. RM12579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387505162|ref|YP_006157418.1|
Domain Number 1 Region: 464-669
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0000654
Family Tricorn protease N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387505162|ref|YP_006157418.1|
Sequence length 1410
Comment hypothetical protein ECO55CA74_01155 [Escherichia coli O55:H7 str. RM12579]
Sequence
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITYANPVNPVLGAKVLPG
ETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDNGGRS
IHFEPLFPGEISYSRSESFWLARGGVAEQHSSQPLSALWQVLPEDVRLSPHMYLATNSLQ
GPWWILNWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAFHRAAEGDVAGAVTGVTDG
AGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLVFPDTLPAGTEYGADNGIRL
EAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGTQVRGFAYDAEHAGRMVAHHY
AGRPESRYRYDDTGRVTEQVNPEGLDYRFEYGQDRVTITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGYNSQ
RQVTSVTYPDGLRSSREYDEKGRLAAETSRSGETTRYSYDDPASELPTGIQDATGSTKQM
AWSRYGQLLTFTDCSGYTTRYEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRE
TRYEYSAAGDLTAIVAPDGSRSEIQYDAWGKAVSTTQGGLTRSMGYDAAGRITVLTNENG
SQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKLTQSEDEGLITLWHYDASDRITHRTVN
GDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVENPETGEMLWEHET
GHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETARSFGGE
AYELATAWNTSGQLRSRHLNLPQLDRDYDWNDNGQLIRISGPQESREYRYSDTGRLTGVH
TTAANLDIDIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLAEKT
DRIPEGVIRMHDERTHHYHYDSQHRLVFHTRIQHGEPQVESRYLYDPLGRRTGKRVWRRE
RDLTGWMSLSRKPEETWYGWDGDRLTTVQTQQTRIQTVYQPGSFTPLLRIETENGEQAKA
RHRSLAEVLQEDTGVTLPAELAVMLGRLERELRQGSVSEESQQWLAQCGLTAEQMAAQLE
AEYIPERKLHLYHCDHRGLPQALISPEGETAWQGEYDEWGNLLGETSAQHLQQPYRLPGQ
QYDEESGLYYNRHRYYDPLQGRYITQDPIDIKGGWNLYSYALNPVSWIDPLGLTQCDSEG
CNNDILFTGGSGPDNKILNELGPRDGIDGLGSQNMKMYSGLLGGDILKPGILGGLTLGSV
TQRPSRTAEEEVQAQIEYLAYKKRCEQKPDSNLSRCAAAIFQKSRKEDCLRMRQEWDDKW
WPGKHADEIKNVKASLKNTLIDVKKKMHAN
Download sequence
Identical sequences A0A0K4B8B0
gi|387505162|ref|YP_006157418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]