SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sclci1|1223291|fgenesh1_kg.191_#_6_#_Locus1437v1rpkm92.77 from Scleroderma citrinum Foug A v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sclci1|1223291|fgenesh1_kg.191_#_6_#_Locus1437v1rpkm92.77
Domain Number 1 Region: 13-127
Classification Level Classification E-value
Superfamily DOPA-like 2.22e-37
Family DOPA dioxygenase-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sclci1|1223291|fgenesh1_kg.191_#_6_#_Locus1437v1rpkm92.77
Sequence length 134
Sequence
MSRSSAYETFPSPIISSRNGFDFHVYFMPSNPVHVKHATELHARIHQEFPELPIYRIWDR
PIGPHPTAMFEVQTMTPHQTGALFSWLVVNRGPLDVLVHPNTDDTYRDHAELATWMGNPW
PLNMEILKAHQARP
Download sequence
Identical sequences A0A0C2ZJT8
jgi|Sclci1|1223291|fgenesh1_kg.191_#_6_#_Locus1437v1rpkm92.77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]