SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sclci1|1208595|fgenesh1_kg.4_#_217_#_Locus279v1rpkm299.70 from Scleroderma citrinum Foug A v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sclci1|1208595|fgenesh1_kg.4_#_217_#_Locus279v1rpkm299.70
Domain Number 1 Region: 172-391
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.28e-88
Family ATP sulfurylase catalytic domain 0.000000014
Further Details:      
 
Domain Number 2 Region: 4-171
Classification Level Classification E-value
Superfamily PUA domain-like 2.68e-54
Family ATP sulfurylase N-terminal domain 0.0000012
Further Details:      
 
Domain Number 3 Region: 392-507,544-573
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.57e-28
Family ATP sulfurylase C-terminal domain 0.0000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sclci1|1208595|fgenesh1_kg.4_#_217_#_Locus279v1rpkm299.70
Sequence length 575
Sequence
MANTPHGGVLKDLVVRDEAISSQLRAEAATLEEVILTDRQLCDLELILNGGFSPLEGFMN
ESDYNSVVDTLRLSDGTLFPMPITLDTSSDEIKRLRITSGARITLRDPRDDEPLAILTVE
DVYTYDRVKEAIQVFGSDDPAHPSVAYLRNRVKEYYIGGKVQAIQAPSHFDYAALRYTPA
ELRAHFKKLSWHRVVAFQTRNPMHRAHRELTIRAARLRQANILIHPVVGLTKPGDVDHFT
RVRVYQAIMTKYPNGMGHLALLPLAMRMGGPREAVWHAIIRKNFGATHFIVGRDHAGPGK
NSQGRDFYGPYDAQELVGRFKDELQIEMVPFQQMTYVPAAEEYQPVDEIPAGMETMNISG
TELRRRLRAGAHIPDWFSYTAVVERLRESYPPRNKQGFVLFLTGLYNSGKDTIAKALQVA
LNEQGGRSVSLLAGESIKGDLHPNLSLTPEERREKLQQIAFVASELARAGAAVVVSPTAP
EERSRALAIDTIASNSGAGGNVFLIHVATPLDHCEKMDRRGMYAQARSGAISGFVGVDVE
YETPKKADLVVDIREQSIPAIVHSIILLLETSSLV
Download sequence
Identical sequences A0A0C3ELW5
jgi|Sclci1|1208595|fgenesh1_kg.4_#_217_#_Locus279v1rpkm299.70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]