SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Sclci1|85801|gw1.82.147.1 from Scleroderma citrinum Foug A v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sclci1|85801|gw1.82.147.1
Domain Number 1 Region: 48-154
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000968
Family Myosin rod fragments 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sclci1|85801|gw1.82.147.1
Sequence length 159
Sequence
MDLSTTTFTPSTYWVVPSFVFVGIGLQYKMPGGIPGLFKRLWHSLWSEKSIEEFQDTVKK
YEDNIQRSEEAKRVLEEKNNALADDIRKLKAENARLSVSIQKASEENAKIQKTAKQEREG
KDAAQRSLEKEQKEGTKARTAYQEEIGALKRQLDIKKSE
Download sequence
Identical sequences A0A0C3A1E8
jgi|Sclci1|85801|gw1.82.147.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]