SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387142897|ref|YP_005731290.1| from Staphylococcus aureus subsp. aureus TW20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387142897|ref|YP_005731290.1|
Domain Number 1 Region: 199-459
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.21e-71
Family Pyruvate oxidase and decarboxylase Pyr module 0.068
Further Details:      
 
Domain Number 2 Region: 4-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.97e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0041
Further Details:      
 
Domain Number 3 Region: 472-582
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.14e-23
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387142897|ref|YP_005731290.1|
Sequence length 586
Comment putative pyruvate flavodoxin/ferredoxinoxidoreductase [Staphylococcus aureus subsp. aureus TW20]
Sequence
MKPQLSWKVGGQQGEGIESTGEIFATAMNRKGYYLYGYRHFSSRIKGGHTNNKIRVSTTP
VHAISDDLDILIAFDQETIDVNHHEMREDSIILADAKAKPVKPEGCHAQLIELPFTATAK
ELGTALMKNMVAIGATSALMNLNTNTFEELITNMFSKKGDKVVEVNIQALNEGYQLMQSR
LPEIYGDFELESTDALPHLYMIGNDAIGLGAIAAGSQFMAAYPITPASEVMEYMIANISK
VNGAVIQTEDEIAAVTMAIGANYGGVRAFTASAGPGLSLMMEAIGLSGMTETPLVIINTQ
RGGPSTGLPTKQEQSDLMQMIYGTHGDIPKIVVAPTDAEDAFYLTMEAFNLAEQYQCPVI
VLSDLQLSLGKQTVEKLDYNRIEIKRGEIIQSDIEREEDDKGYFKRYALTSDGVSPRPIP
GVKGGIHHITGVEHNEEGKPSESASNRQQQMEKRMRKIEQLLIESPVEANLQHEDADILY
IGFISTKGAIQEGSNRLNQQGIKVNTIQIRQLHPFPTSVIQDAVNKAKKVVVVEHNYQGQ
LASIIKMNVNIHDKIENYTKYDGTPFLPHEIEEKGKIIATEIKEMV
Download sequence
Identical sequences A0A0D6HQE4 A0A0E1AKM1 A0A0H2WYT5 A0A0H2XHA9 A0A0H3K8F3 A0A1E8WW31 A0A2K1ACS2 Q2FZ05
gi|479329203|ref|YP_007868262.1| gi|87161524|ref|YP_493879.1| gi|554644087|ref|YP_008715878.1| gi|384869824|ref|YP_005752538.1| gi|384861882|ref|YP_005744602.1| 426430.NWMN_1198 451515.SAUSA300_1182 451516.USA300HOU_1221 93061.SAOUHSC_01266 93062.SACOL1308 gi|379014480|ref|YP_005290716.1| gi|57651859|ref|YP_186165.1| gi|161509455|ref|YP_001575114.1| gi|88194999|ref|YP_499799.1| WP_000804328.1.100013 WP_000804328.1.100041 WP_000804328.1.100049 WP_000804328.1.100057 WP_000804328.1.100067 WP_000804328.1.100072 WP_000804328.1.100088 WP_000804328.1.100090 WP_000804328.1.100094 WP_000804328.1.100154 WP_000804328.1.100180 WP_000804328.1.100189 WP_000804328.1.100298 WP_000804328.1.100307 WP_000804328.1.100352 WP_000804328.1.100391 WP_000804328.1.10041 WP_000804328.1.100618 WP_000804328.1.100631 WP_000804328.1.100647 WP_000804328.1.100761 WP_000804328.1.100768 WP_000804328.1.100834 WP_000804328.1.100903 WP_000804328.1.100920 WP_000804328.1.100963 WP_000804328.1.100981 WP_000804328.1.100987 WP_000804328.1.101017 WP_000804328.1.101084 WP_000804328.1.101177 WP_000804328.1.101240 WP_000804328.1.101266 WP_000804328.1.101327 WP_000804328.1.101375 WP_000804328.1.101393 WP_000804328.1.101490 WP_000804328.1.101566 WP_000804328.1.101570 WP_000804328.1.101615 WP_000804328.1.10166 WP_000804328.1.101725 WP_000804328.1.101757 WP_000804328.1.101788 WP_000804328.1.101950 WP_000804328.1.1022 WP_000804328.1.10232 WP_000804328.1.10397 WP_000804328.1.10431 WP_000804328.1.10486 WP_000804328.1.10503 WP_000804328.1.10542 WP_000804328.1.10543 WP_000804328.1.10565 WP_000804328.1.10614 WP_000804328.1.10679 WP_000804328.1.10707 WP_000804328.1.10726 WP_000804328.1.10742 WP_000804328.1.10950 WP_000804328.1.11129 WP_000804328.1.1120 WP_000804328.1.11287 WP_000804328.1.11294 WP_000804328.1.11348 WP_000804328.1.11353 WP_000804328.1.1136 WP_000804328.1.11377 WP_000804328.1.11407 WP_000804328.1.11488 WP_000804328.1.11492 WP_000804328.1.11525 WP_000804328.1.11558 WP_000804328.1.11592 WP_000804328.1.11665 WP_000804328.1.11692 WP_000804328.1.117 WP_000804328.1.11719 WP_000804328.1.11720 WP_000804328.1.11795 WP_000804328.1.11829 WP_000804328.1.11991 WP_000804328.1.12005 WP_000804328.1.1205 WP_000804328.1.12073 WP_000804328.1.12098 WP_000804328.1.12123 WP_000804328.1.12179 WP_000804328.1.12181 WP_000804328.1.12226 WP_000804328.1.12233 WP_000804328.1.12297 WP_000804328.1.12328 WP_000804328.1.12447 WP_000804328.1.12498 WP_000804328.1.12639 WP_000804328.1.12715 WP_000804328.1.12771 WP_000804328.1.12822 WP_000804328.1.12833 WP_000804328.1.12845 WP_000804328.1.12862 WP_000804328.1.12903 WP_000804328.1.12937 WP_000804328.1.12938 WP_000804328.1.13039 WP_000804328.1.13091 WP_000804328.1.13104 WP_000804328.1.13322 WP_000804328.1.13468 WP_000804328.1.13531 WP_000804328.1.1355 WP_000804328.1.13556 WP_000804328.1.13568 WP_000804328.1.13617 WP_000804328.1.13654 WP_000804328.1.13683 WP_000804328.1.13726 WP_000804328.1.1374 WP_000804328.1.13755 WP_000804328.1.13757 WP_000804328.1.13772 WP_000804328.1.13804 WP_000804328.1.13805 WP_000804328.1.13914 WP_000804328.1.13940 WP_000804328.1.13983 WP_000804328.1.14071 WP_000804328.1.14112 WP_000804328.1.14153 WP_000804328.1.14233 WP_000804328.1.1426 WP_000804328.1.14364 WP_000804328.1.14365 WP_000804328.1.14366 WP_000804328.1.14394 WP_000804328.1.14418 WP_000804328.1.14475 WP_000804328.1.147 WP_000804328.1.14744 WP_000804328.1.1477 WP_000804328.1.14790 WP_000804328.1.14809 WP_000804328.1.14869 WP_000804328.1.14888 WP_000804328.1.14902 WP_000804328.1.14987 WP_000804328.1.15000 WP_000804328.1.15091 WP_000804328.1.15228 WP_000804328.1.15255 WP_000804328.1.15263 WP_000804328.1.15278 WP_000804328.1.15329 WP_000804328.1.15399 WP_000804328.1.15409 WP_000804328.1.15438 WP_000804328.1.1545 WP_000804328.1.15489 WP_000804328.1.15505 WP_000804328.1.15524 WP_000804328.1.15572 WP_000804328.1.15687 WP_000804328.1.15706 WP_000804328.1.1579 WP_000804328.1.15818 WP_000804328.1.1583 WP_000804328.1.15838 WP_000804328.1.15883 WP_000804328.1.15897 WP_000804328.1.15898 WP_000804328.1.15928 WP_000804328.1.15957 WP_000804328.1.15972 WP_000804328.1.1600 WP_000804328.1.1606 WP_000804328.1.16112 WP_000804328.1.16213 WP_000804328.1.16237 WP_000804328.1.16362 WP_000804328.1.16417 WP_000804328.1.16554 WP_000804328.1.16569 WP_000804328.1.16603 WP_000804328.1.16617 WP_000804328.1.16628 WP_000804328.1.16672 WP_000804328.1.16679 WP_000804328.1.16688 WP_000804328.1.16703 WP_000804328.1.16757 WP_000804328.1.16768 WP_000804328.1.16770 WP_000804328.1.16776 WP_000804328.1.16892 WP_000804328.1.16946 WP_000804328.1.17038 WP_000804328.1.17104 WP_000804328.1.17137 WP_000804328.1.17169 WP_000804328.1.17210 WP_000804328.1.17231 WP_000804328.1.17234 WP_000804328.1.17249 WP_000804328.1.17256 WP_000804328.1.17320 WP_000804328.1.17450 WP_000804328.1.17485 WP_000804328.1.17520 WP_000804328.1.17581 WP_000804328.1.17650 WP_000804328.1.17657 WP_000804328.1.17666 WP_000804328.1.17676 WP_000804328.1.17770 WP_000804328.1.17834 WP_000804328.1.17845 WP_000804328.1.17859 WP_000804328.1.17876 WP_000804328.1.17929 WP_000804328.1.17951 WP_000804328.1.18016 WP_000804328.1.18074 WP_000804328.1.18105 WP_000804328.1.18197 WP_000804328.1.18283 WP_000804328.1.18290 WP_000804328.1.18320 WP_000804328.1.18437 WP_000804328.1.18451 WP_000804328.1.1851 WP_000804328.1.18516 WP_000804328.1.18529 WP_000804328.1.18538 WP_000804328.1.18562 WP_000804328.1.18611 WP_000804328.1.18627 WP_000804328.1.18658 WP_000804328.1.18668 WP_000804328.1.18758 WP_000804328.1.18809 WP_000804328.1.18830 WP_000804328.1.18836 WP_000804328.1.18879 WP_000804328.1.18918 WP_000804328.1.18938 WP_000804328.1.18987 WP_000804328.1.19009 WP_000804328.1.1901 WP_000804328.1.19027 WP_000804328.1.19149 WP_000804328.1.19179 WP_000804328.1.192 WP_000804328.1.19272 WP_000804328.1.19390 WP_000804328.1.19411 WP_000804328.1.19444 WP_000804328.1.19509 WP_000804328.1.19733 WP_000804328.1.1975 WP_000804328.1.19765 WP_000804328.1.19775 WP_000804328.1.19807 WP_000804328.1.19853 WP_000804328.1.20057 WP_000804328.1.20101 WP_000804328.1.2013 WP_000804328.1.20155 WP_000804328.1.20160 WP_000804328.1.20210 WP_000804328.1.20235 WP_000804328.1.20354 WP_000804328.1.20386 WP_000804328.1.20473 WP_000804328.1.20554 WP_000804328.1.20772 WP_000804328.1.20833 WP_000804328.1.20838 WP_000804328.1.20860 WP_000804328.1.20975 WP_000804328.1.21013 WP_000804328.1.21054 WP_000804328.1.21080 WP_000804328.1.21081 WP_000804328.1.2128 WP_000804328.1.21312 WP_000804328.1.21356 WP_000804328.1.21386 WP_000804328.1.21402 WP_000804328.1.21465 WP_000804328.1.2154 WP_000804328.1.21601 WP_000804328.1.21679 WP_000804328.1.21712 WP_000804328.1.21820 WP_000804328.1.21890 WP_000804328.1.21901 WP_000804328.1.22163 WP_000804328.1.22165 WP_000804328.1.22170 WP_000804328.1.22174 WP_000804328.1.22246 WP_000804328.1.22332 WP_000804328.1.22344 WP_000804328.1.22351 WP_000804328.1.22367 WP_000804328.1.22526 WP_000804328.1.22551 WP_000804328.1.22657 WP_000804328.1.22730 WP_000804328.1.22731 WP_000804328.1.2280 WP_000804328.1.22811 WP_000804328.1.22843 WP_000804328.1.22859 WP_000804328.1.22994 WP_000804328.1.23004 WP_000804328.1.23152 WP_000804328.1.23228 WP_000804328.1.23238 WP_000804328.1.23381 WP_000804328.1.23420 WP_000804328.1.23450 WP_000804328.1.23489 WP_000804328.1.23491 WP_000804328.1.23541 WP_000804328.1.23544 WP_000804328.1.23586 WP_000804328.1.23613 WP_000804328.1.23626 WP_000804328.1.2365 WP_000804328.1.23822 WP_000804328.1.23849 WP_000804328.1.23907 WP_000804328.1.23998 WP_000804328.1.24148 WP_000804328.1.24167 WP_000804328.1.2423 WP_000804328.1.24241 WP_000804328.1.24279 WP_000804328.1.24364 WP_000804328.1.24418 WP_000804328.1.2442 WP_000804328.1.24443 WP_000804328.1.24478 WP_000804328.1.2458 WP_000804328.1.24617 WP_000804328.1.24745 WP_000804328.1.2480 WP_000804328.1.24802 WP_000804328.1.24891 WP_000804328.1.25083 WP_000804328.1.25170 WP_000804328.1.25438 WP_000804328.1.25469 WP_000804328.1.25479 WP_000804328.1.25511 WP_000804328.1.25567 WP_000804328.1.25593 WP_000804328.1.25634 WP_000804328.1.25737 WP_000804328.1.25770 WP_000804328.1.25820 WP_000804328.1.25867 WP_000804328.1.25868 WP_000804328.1.25881 WP_000804328.1.25891 WP_000804328.1.2593 WP_000804328.1.26006 WP_000804328.1.26015 WP_000804328.1.262 WP_000804328.1.26293 WP_000804328.1.26307 WP_000804328.1.26370 WP_000804328.1.26481 WP_000804328.1.2656 WP_000804328.1.2658 WP_000804328.1.2661 WP_000804328.1.2664 WP_000804328.1.26663 WP_000804328.1.26733 WP_000804328.1.26771 WP_000804328.1.26790 WP_000804328.1.26927 WP_000804328.1.26958 WP_000804328.1.27042 WP_000804328.1.27154 WP_000804328.1.27246 WP_000804328.1.27311 WP_000804328.1.27333 WP_000804328.1.2734 WP_000804328.1.27345 WP_000804328.1.27455 WP_000804328.1.27457 WP_000804328.1.27551 WP_000804328.1.27562 WP_000804328.1.2759 WP_000804328.1.27608 WP_000804328.1.27614 WP_000804328.1.27615 WP_000804328.1.27621 WP_000804328.1.27654 WP_000804328.1.27670 WP_000804328.1.2768 WP_000804328.1.27717 WP_000804328.1.27748 WP_000804328.1.27817 WP_000804328.1.27854 WP_000804328.1.27950 WP_000804328.1.27953 WP_000804328.1.27972 WP_000804328.1.28007 WP_000804328.1.28025 WP_000804328.1.28063 WP_000804328.1.28071 WP_000804328.1.28088 WP_000804328.1.28117 WP_000804328.1.28138 WP_000804328.1.28147 WP_000804328.1.28158 WP_000804328.1.28191 WP_000804328.1.28207 WP_000804328.1.28358 WP_000804328.1.28360 WP_000804328.1.28376 WP_000804328.1.28381 WP_000804328.1.28477 WP_000804328.1.28498 WP_000804328.1.28502 WP_000804328.1.28527 WP_000804328.1.28532 WP_000804328.1.28629 WP_000804328.1.28650 WP_000804328.1.28675 WP_000804328.1.28710 WP_000804328.1.28862 WP_000804328.1.28887 WP_000804328.1.28933 WP_000804328.1.28960 WP_000804328.1.28970 WP_000804328.1.29090 WP_000804328.1.29107 WP_000804328.1.29188 WP_000804328.1.29207 WP_000804328.1.29272 WP_000804328.1.29282 WP_000804328.1.29285 WP_000804328.1.29312 WP_000804328.1.29372 WP_000804328.1.29373 WP_000804328.1.29381 WP_000804328.1.29511 WP_000804328.1.29541 WP_000804328.1.29561 WP_000804328.1.29596 WP_000804328.1.29644 WP_000804328.1.29676 WP_000804328.1.2975 WP_000804328.1.29758 WP_000804328.1.29781 WP_000804328.1.29805 WP_000804328.1.29885 WP_000804328.1.29963 WP_000804328.1.30012 WP_000804328.1.30023 WP_000804328.1.30033 WP_000804328.1.30057 WP_000804328.1.30154 WP_000804328.1.30176 WP_000804328.1.30274 WP_000804328.1.30333 WP_000804328.1.30367 WP_000804328.1.30376 WP_000804328.1.30381 WP_000804328.1.30418 WP_000804328.1.30422 WP_000804328.1.30477 WP_000804328.1.30530 WP_000804328.1.30623 WP_000804328.1.30758 WP_000804328.1.30779 WP_000804328.1.30846 WP_000804328.1.30862 WP_000804328.1.30863 WP_000804328.1.30874 WP_000804328.1.30878 WP_000804328.1.30889 WP_000804328.1.30916 WP_000804328.1.3097 WP_000804328.1.30971 WP_000804328.1.30998 WP_000804328.1.31037 WP_000804328.1.31068 WP_000804328.1.31124 WP_000804328.1.31194 WP_000804328.1.31376 WP_000804328.1.31462 WP_000804328.1.31478 WP_000804328.1.315 WP_000804328.1.31567 WP_000804328.1.31611 WP_000804328.1.31638 WP_000804328.1.31667 WP_000804328.1.31787 WP_000804328.1.31797 WP_000804328.1.31817 WP_000804328.1.31897 WP_000804328.1.31925 WP_000804328.1.31949 WP_000804328.1.31990 WP_000804328.1.31994 WP_000804328.1.32059 WP_000804328.1.32118 WP_000804328.1.32122 WP_000804328.1.32125 WP_000804328.1.32167 WP_000804328.1.32217 WP_000804328.1.32244 WP_000804328.1.32248 WP_000804328.1.32281 WP_000804328.1.32295 WP_000804328.1.32365 WP_000804328.1.32384 WP_000804328.1.32405 WP_000804328.1.3244 WP_000804328.1.32454 WP_000804328.1.32464 WP_000804328.1.32739 WP_000804328.1.32839 WP_000804328.1.32921 WP_000804328.1.32987 WP_000804328.1.3299 WP_000804328.1.3306 WP_000804328.1.33108 WP_000804328.1.33147 WP_000804328.1.33213 WP_000804328.1.33252 WP_000804328.1.33255 WP_000804328.1.33307 WP_000804328.1.3335 WP_000804328.1.33350 WP_000804328.1.33372 WP_000804328.1.3338 WP_000804328.1.33388 WP_000804328.1.33394 WP_000804328.1.33426 WP_000804328.1.3345 WP_000804328.1.33463 WP_000804328.1.33483 WP_000804328.1.33484 WP_000804328.1.33520 WP_000804328.1.33575 WP_000804328.1.33650 WP_000804328.1.33724 WP_000804328.1.33737 WP_000804328.1.33756 WP_000804328.1.33766 WP_000804328.1.33778 WP_000804328.1.33899 WP_000804328.1.33949 WP_000804328.1.33994 WP_000804328.1.34069 WP_000804328.1.34105 WP_000804328.1.34112 WP_000804328.1.3418 WP_000804328.1.34194 WP_000804328.1.34361 WP_000804328.1.3442 WP_000804328.1.34471 WP_000804328.1.34512 WP_000804328.1.34569 WP_000804328.1.34716 WP_000804328.1.34723 WP_000804328.1.3474 WP_000804328.1.34741 WP_000804328.1.34847 WP_000804328.1.34865 WP_000804328.1.34923 WP_000804328.1.34926 WP_000804328.1.34967 WP_000804328.1.35014 WP_000804328.1.35031 WP_000804328.1.35032 WP_000804328.1.35289 WP_000804328.1.35314 WP_000804328.1.35340 WP_000804328.1.35391 WP_000804328.1.35413 WP_000804328.1.35508 WP_000804328.1.35517 WP_000804328.1.35519 WP_000804328.1.35549 WP_000804328.1.35642 WP_000804328.1.35661 WP_000804328.1.35686 WP_000804328.1.35696 WP_000804328.1.35784 WP_000804328.1.3579 WP_000804328.1.35837 WP_000804328.1.35890 WP_000804328.1.35903 WP_000804328.1.36093 WP_000804328.1.36179 WP_000804328.1.36249 WP_000804328.1.36302 WP_000804328.1.36430 WP_000804328.1.36434 WP_000804328.1.36439 WP_000804328.1.36640 WP_000804328.1.36704 WP_000804328.1.36729 WP_000804328.1.36773 WP_000804328.1.36814 WP_000804328.1.36847 WP_000804328.1.36888 WP_000804328.1.36903 WP_000804328.1.36911 WP_000804328.1.3709 WP_000804328.1.37120 WP_000804328.1.37130 WP_000804328.1.37145 WP_000804328.1.37159 WP_000804328.1.3722 WP_000804328.1.37335 WP_000804328.1.37378 WP_000804328.1.37411 WP_000804328.1.37435 WP_000804328.1.37546 WP_000804328.1.37644 WP_000804328.1.37669 WP_000804328.1.37679 WP_000804328.1.3774 WP_000804328.1.37749 WP_000804328.1.37764 WP_000804328.1.37771 WP_000804328.1.37788 WP_000804328.1.37851 WP_000804328.1.37906 WP_000804328.1.37907 WP_000804328.1.37929 WP_000804328.1.38030 WP_000804328.1.38111 WP_000804328.1.38128 WP_000804328.1.38136 WP_000804328.1.38222 WP_000804328.1.38304 WP_000804328.1.38516 WP_000804328.1.38555 WP_000804328.1.38688 WP_000804328.1.38875 WP_000804328.1.38885 WP_000804328.1.38890 WP_000804328.1.38927 WP_000804328.1.39017 WP_000804328.1.39026 WP_000804328.1.39166 WP_000804328.1.39330 WP_000804328.1.39361 WP_000804328.1.39432 WP_000804328.1.39499 WP_000804328.1.39542 WP_000804328.1.39642 WP_000804328.1.39670 WP_000804328.1.39671 WP_000804328.1.39682 WP_000804328.1.39693 WP_000804328.1.39857 WP_000804328.1.39943 WP_000804328.1.39995 WP_000804328.1.40076 WP_000804328.1.4010 WP_000804328.1.40149 WP_000804328.1.40247 WP_000804328.1.40329 WP_000804328.1.40369 WP_000804328.1.40428 WP_000804328.1.40613 WP_000804328.1.40670 WP_000804328.1.40700 WP_000804328.1.40719 WP_000804328.1.40729 WP_000804328.1.40780 WP_000804328.1.40814 WP_000804328.1.40939 WP_000804328.1.40997 WP_000804328.1.41033 WP_000804328.1.41038 WP_000804328.1.4105 WP_000804328.1.41350 WP_000804328.1.41374 WP_000804328.1.41386 WP_000804328.1.41389 WP_000804328.1.41555 WP_000804328.1.41581 WP_000804328.1.41587 WP_000804328.1.41598 WP_000804328.1.41612 WP_000804328.1.41620 WP_000804328.1.41681 WP_000804328.1.4169 WP_000804328.1.41743 WP_000804328.1.41755 WP_000804328.1.41796 WP_000804328.1.4182 WP_000804328.1.41863 WP_000804328.1.41972 WP_000804328.1.42003 WP_000804328.1.4202 WP_000804328.1.42056 WP_000804328.1.42072 WP_000804328.1.42085 WP_000804328.1.42169 WP_000804328.1.42178 WP_000804328.1.42241 WP_000804328.1.4225 WP_000804328.1.42298 WP_000804328.1.42325 WP_000804328.1.42344 WP_000804328.1.42607 WP_000804328.1.42681 WP_000804328.1.42733 WP_000804328.1.42764 WP_000804328.1.42788 WP_000804328.1.42798 WP_000804328.1.42816 WP_000804328.1.42907 WP_000804328.1.42925 WP_000804328.1.42959 WP_000804328.1.42984 WP_000804328.1.43023 WP_000804328.1.43061 WP_000804328.1.43095 WP_000804328.1.43110 WP_000804328.1.43125 WP_000804328.1.43139 WP_000804328.1.43168 WP_000804328.1.43179 WP_000804328.1.43204 WP_000804328.1.43252 WP_000804328.1.43279 WP_000804328.1.43360 WP_000804328.1.43375 WP_000804328.1.43405 WP_000804328.1.43446 WP_000804328.1.43512 WP_000804328.1.43665 WP_000804328.1.4386 WP_000804328.1.43995 WP_000804328.1.44177 WP_000804328.1.44178 WP_000804328.1.44344 WP_000804328.1.44382 WP_000804328.1.44432 WP_000804328.1.44504 WP_000804328.1.44515 WP_000804328.1.44520 WP_000804328.1.44586 WP_000804328.1.44623 WP_000804328.1.44655 WP_000804328.1.44667 WP_000804328.1.447 WP_000804328.1.44714 WP_000804328.1.44715 WP_000804328.1.44856 WP_000804328.1.44876 WP_000804328.1.44892 WP_000804328.1.44940 WP_000804328.1.44993 WP_000804328.1.45042 WP_000804328.1.45080 WP_000804328.1.45091 WP_000804328.1.45094 WP_000804328.1.45140 WP_000804328.1.45157 WP_000804328.1.45162 WP_000804328.1.45223 WP_000804328.1.45242 WP_000804328.1.45267 WP_000804328.1.4527 WP_000804328.1.45281 WP_000804328.1.4545 WP_000804328.1.45450 WP_000804328.1.45456 WP_000804328.1.4546 WP_000804328.1.45542 WP_000804328.1.45555 WP_000804328.1.45574 WP_000804328.1.45610 WP_000804328.1.45645 WP_000804328.1.45705 WP_000804328.1.45763 WP_000804328.1.4577 WP_000804328.1.45773 WP_000804328.1.4582 WP_000804328.1.45862 WP_000804328.1.45874 WP_000804328.1.4597 WP_000804328.1.45972 WP_000804328.1.45977 WP_000804328.1.46035 WP_000804328.1.46037 WP_000804328.1.46050 WP_000804328.1.46062 WP_000804328.1.46078 WP_000804328.1.46171 WP_000804328.1.46172 WP_000804328.1.46248 WP_000804328.1.46333 WP_000804328.1.46339 WP_000804328.1.46353 WP_000804328.1.46529 WP_000804328.1.46619 WP_000804328.1.46648 WP_000804328.1.46720 WP_000804328.1.46736 WP_000804328.1.46770 WP_000804328.1.4680 WP_000804328.1.46906 WP_000804328.1.46914 WP_000804328.1.46929 WP_000804328.1.4694 WP_000804328.1.46947 WP_000804328.1.47002 WP_000804328.1.47107 WP_000804328.1.47111 WP_000804328.1.47282 WP_000804328.1.47334 WP_000804328.1.47408 WP_000804328.1.47459 WP_000804328.1.47522 WP_000804328.1.47617 WP_000804328.1.47669 WP_000804328.1.47680 WP_000804328.1.47747 WP_000804328.1.47851 WP_000804328.1.47908 WP_000804328.1.4792 WP_000804328.1.48046 WP_000804328.1.48064 WP_000804328.1.48067 WP_000804328.1.48116 WP_000804328.1.48142 WP_000804328.1.48156 WP_000804328.1.48187 WP_000804328.1.48223 WP_000804328.1.48272 WP_000804328.1.48338 WP_000804328.1.48376 WP_000804328.1.48398 WP_000804328.1.4840 WP_000804328.1.48427 WP_000804328.1.48437 WP_000804328.1.48438 WP_000804328.1.48479 WP_000804328.1.4852 WP_000804328.1.48580 WP_000804328.1.48664 WP_000804328.1.48670 WP_000804328.1.48769 WP_000804328.1.48782 WP_000804328.1.48869 WP_000804328.1.49018 WP_000804328.1.49071 WP_000804328.1.49094 WP_000804328.1.49105 WP_000804328.1.49171 WP_000804328.1.49189 WP_000804328.1.49196 WP_000804328.1.49199 WP_000804328.1.4924 WP_000804328.1.49257 WP_000804328.1.49301 WP_000804328.1.49362 WP_000804328.1.49418 WP_000804328.1.4945 WP_000804328.1.49518 WP_000804328.1.49549 WP_000804328.1.49581 WP_000804328.1.49582 WP_000804328.1.496 WP_000804328.1.49603 WP_000804328.1.49643 WP_000804328.1.49672 WP_000804328.1.49690 WP_000804328.1.49728 WP_000804328.1.49732 WP_000804328.1.49745 WP_000804328.1.49819 WP_000804328.1.49918 WP_000804328.1.49935 WP_000804328.1.50028 WP_000804328.1.50117 WP_000804328.1.50145 WP_000804328.1.50178 WP_000804328.1.50192 WP_000804328.1.50291 WP_000804328.1.50367 WP_000804328.1.50388 WP_000804328.1.5045 WP_000804328.1.50464 WP_000804328.1.50525 WP_000804328.1.50558 WP_000804328.1.50568 WP_000804328.1.5059 WP_000804328.1.50594 WP_000804328.1.50647 WP_000804328.1.50699 WP_000804328.1.50740 WP_000804328.1.50817 WP_000804328.1.50829 WP_000804328.1.50974 WP_000804328.1.51015 WP_000804328.1.51130 WP_000804328.1.51209 WP_000804328.1.51226 WP_000804328.1.51271 WP_000804328.1.51277 WP_000804328.1.51326 WP_000804328.1.51393 WP_000804328.1.51496 WP_000804328.1.51557 WP_000804328.1.51741 WP_000804328.1.51794 WP_000804328.1.51824 WP_000804328.1.52034 WP_000804328.1.52061 WP_000804328.1.52072 WP_000804328.1.52195 WP_000804328.1.52198 WP_000804328.1.52210 WP_000804328.1.52289 WP_000804328.1.52308 WP_000804328.1.52343 WP_000804328.1.52377 WP_000804328.1.52396 WP_000804328.1.52427 WP_000804328.1.5251 WP_000804328.1.52511 WP_000804328.1.52605 WP_000804328.1.52830 WP_000804328.1.52889 WP_000804328.1.52900 WP_000804328.1.52965 WP_000804328.1.52983 WP_000804328.1.5304 WP_000804328.1.53050 WP_000804328.1.53057 WP_000804328.1.5319 WP_000804328.1.53245 WP_000804328.1.53312 WP_000804328.1.53363 WP_000804328.1.53373 WP_000804328.1.53379 WP_000804328.1.53408 WP_000804328.1.53452 WP_000804328.1.53467 WP_000804328.1.5347 WP_000804328.1.53532 WP_000804328.1.53774 WP_000804328.1.53799 WP_000804328.1.53911 WP_000804328.1.53926 WP_000804328.1.54049 WP_000804328.1.54074 WP_000804328.1.54086 WP_000804328.1.54237 WP_000804328.1.54290 WP_000804328.1.54404 WP_000804328.1.54438 WP_000804328.1.54471 WP_000804328.1.54479 WP_000804328.1.54485 WP_000804328.1.54574 WP_000804328.1.54744 WP_000804328.1.54830 WP_000804328.1.54851 WP_000804328.1.54929 WP_000804328.1.54931 WP_000804328.1.54967 WP_000804328.1.54990 WP_000804328.1.5500 WP_000804328.1.55004 WP_000804328.1.55082 WP_000804328.1.55084 WP_000804328.1.55095 WP_000804328.1.5518 WP_000804328.1.552 WP_000804328.1.55239 WP_000804328.1.55271 WP_000804328.1.55336 WP_000804328.1.55419 WP_000804328.1.55495 WP_000804328.1.5550 WP_000804328.1.55535 WP_000804328.1.55603 WP_000804328.1.55719 WP_000804328.1.55724 WP_000804328.1.55845 WP_000804328.1.55955 WP_000804328.1.56003 WP_000804328.1.5604 WP_000804328.1.56064 WP_000804328.1.56106 WP_000804328.1.56135 WP_000804328.1.56159 WP_000804328.1.56200 WP_000804328.1.56220 WP_000804328.1.56237 WP_000804328.1.56265 WP_000804328.1.56387 WP_000804328.1.56464 WP_000804328.1.56482 WP_000804328.1.56527 WP_000804328.1.56542 WP_000804328.1.56608 WP_000804328.1.56619 WP_000804328.1.56702 WP_000804328.1.56708 WP_000804328.1.56737 WP_000804328.1.5675 WP_000804328.1.56779 WP_000804328.1.56822 WP_000804328.1.56903 WP_000804328.1.56931 WP_000804328.1.56966 WP_000804328.1.56975 WP_000804328.1.57015 WP_000804328.1.5705 WP_000804328.1.57081 WP_000804328.1.57115 WP_000804328.1.57330 WP_000804328.1.57427 WP_000804328.1.57448 WP_000804328.1.57593 WP_000804328.1.57670 WP_000804328.1.57693 WP_000804328.1.57701 WP_000804328.1.57718 WP_000804328.1.57727 WP_000804328.1.57745 WP_000804328.1.57783 WP_000804328.1.57844 WP_000804328.1.57962 WP_000804328.1.5799 WP_000804328.1.58006 WP_000804328.1.58051 WP_000804328.1.58122 WP_000804328.1.5817 WP_000804328.1.58185 WP_000804328.1.58246 WP_000804328.1.58325 WP_000804328.1.58350 WP_000804328.1.58353 WP_000804328.1.58366 WP_000804328.1.58373 WP_000804328.1.58392 WP_000804328.1.58421 WP_000804328.1.58481 WP_000804328.1.5849 WP_000804328.1.58508 WP_000804328.1.58521 WP_000804328.1.586 WP_000804328.1.58603 WP_000804328.1.58714 WP_000804328.1.58775 WP_000804328.1.58936 WP_000804328.1.58998 WP_000804328.1.5901 WP_000804328.1.5904 WP_000804328.1.59133 WP_000804328.1.5925 WP_000804328.1.59269 WP_000804328.1.59284 WP_000804328.1.59327 WP_000804328.1.59363 WP_000804328.1.59397 WP_000804328.1.59457 WP_000804328.1.59459 WP_000804328.1.59467 WP_000804328.1.59603 WP_000804328.1.59609 WP_000804328.1.59629 WP_000804328.1.59663 WP_000804328.1.59697 WP_000804328.1.59886 WP_000804328.1.59945 WP_000804328.1.59977 WP_000804328.1.60022 WP_000804328.1.60086 WP_000804328.1.60156 WP_000804328.1.60251 WP_000804328.1.60259 WP_000804328.1.60280 WP_000804328.1.60307 WP_000804328.1.60368 WP_000804328.1.60462 WP_000804328.1.60515 WP_000804328.1.60551 WP_000804328.1.60594 WP_000804328.1.60690 WP_000804328.1.60696 WP_000804328.1.60787 WP_000804328.1.60939 WP_000804328.1.60981 WP_000804328.1.61030 WP_000804328.1.61119 WP_000804328.1.61152 WP_000804328.1.61153 WP_000804328.1.6118 WP_000804328.1.61257 WP_000804328.1.61324 WP_000804328.1.61339 WP_000804328.1.61408 WP_000804328.1.61413 WP_000804328.1.61421 WP_000804328.1.61547 WP_000804328.1.61591 WP_000804328.1.6168 WP_000804328.1.61784 WP_000804328.1.61910 WP_000804328.1.61970 WP_000804328.1.62030 WP_000804328.1.62088 WP_000804328.1.62093 WP_000804328.1.62140 WP_000804328.1.62164 WP_000804328.1.62367 WP_000804328.1.62409 WP_000804328.1.62459 WP_000804328.1.62537 WP_000804328.1.62539 WP_000804328.1.62575 WP_000804328.1.62685 WP_000804328.1.62740 WP_000804328.1.62756 WP_000804328.1.62781 WP_000804328.1.62796 WP_000804328.1.62808 WP_000804328.1.62829 WP_000804328.1.62842 WP_000804328.1.62878 WP_000804328.1.62956 WP_000804328.1.63011 WP_000804328.1.63050 WP_000804328.1.631 WP_000804328.1.63132 WP_000804328.1.63182 WP_000804328.1.63195 WP_000804328.1.63233 WP_000804328.1.63273 WP_000804328.1.63279 WP_000804328.1.63307 WP_000804328.1.63324 WP_000804328.1.63335 WP_000804328.1.63337 WP_000804328.1.63383 WP_000804328.1.63406 WP_000804328.1.63411 WP_000804328.1.63421 WP_000804328.1.63460 WP_000804328.1.63510 WP_000804328.1.63527 WP_000804328.1.63565 WP_000804328.1.63617 WP_000804328.1.63693 WP_000804328.1.63705 WP_000804328.1.6378 WP_000804328.1.63847 WP_000804328.1.63894 WP_000804328.1.64012 WP_000804328.1.64094 WP_000804328.1.64108 WP_000804328.1.64251 WP_000804328.1.64303 WP_000804328.1.64368 WP_000804328.1.64628 WP_000804328.1.64643 WP_000804328.1.64665 WP_000804328.1.64811 WP_000804328.1.64845 WP_000804328.1.64860 WP_000804328.1.64951 WP_000804328.1.64956 WP_000804328.1.64996 WP_000804328.1.64998 WP_000804328.1.65025 WP_000804328.1.65038 WP_000804328.1.65076 WP_000804328.1.65233 WP_000804328.1.65264 WP_000804328.1.65358 WP_000804328.1.65387 WP_000804328.1.65406 WP_000804328.1.65407 WP_000804328.1.6544 WP_000804328.1.65585 WP_000804328.1.65616 WP_000804328.1.65629 WP_000804328.1.65643 WP_000804328.1.65656 WP_000804328.1.6568 WP_000804328.1.65713 WP_000804328.1.65734 WP_000804328.1.65769 WP_000804328.1.65809 WP_000804328.1.6585 WP_000804328.1.65892 WP_000804328.1.65935 WP_000804328.1.65947 WP_000804328.1.65965 WP_000804328.1.6603 WP_000804328.1.66054 WP_000804328.1.66069 WP_000804328.1.66073 WP_000804328.1.66130 WP_000804328.1.66144 WP_000804328.1.66265 WP_000804328.1.66298 WP_000804328.1.6632 WP_000804328.1.66453 WP_000804328.1.66513 WP_000804328.1.66556 WP_000804328.1.66598 WP_000804328.1.66611 WP_000804328.1.66614 WP_000804328.1.66705 WP_000804328.1.66756 WP_000804328.1.66766 WP_000804328.1.66803 WP_000804328.1.66816 WP_000804328.1.6688 WP_000804328.1.66938 WP_000804328.1.66969 WP_000804328.1.67012 WP_000804328.1.67014 WP_000804328.1.67067 WP_000804328.1.67072 WP_000804328.1.67113 WP_000804328.1.67155 WP_000804328.1.67160 WP_000804328.1.67238 WP_000804328.1.67251 WP_000804328.1.67259 WP_000804328.1.67286 WP_000804328.1.67294 WP_000804328.1.67312 WP_000804328.1.67328 WP_000804328.1.67418 WP_000804328.1.67420 WP_000804328.1.67425 WP_000804328.1.67457 WP_000804328.1.67460 WP_000804328.1.67540 WP_000804328.1.67571 WP_000804328.1.67621 WP_000804328.1.67644 WP_000804328.1.67653 WP_000804328.1.67691 WP_000804328.1.67806 WP_000804328.1.67867 WP_000804328.1.67880 WP_000804328.1.67900 WP_000804328.1.67991 WP_000804328.1.68101 WP_000804328.1.68134 WP_000804328.1.68141 WP_000804328.1.68152 WP_000804328.1.68202 WP_000804328.1.68221 WP_000804328.1.68223 WP_000804328.1.6824 WP_000804328.1.68268 WP_000804328.1.68299 WP_000804328.1.68355 WP_000804328.1.68366 WP_000804328.1.68398 WP_000804328.1.68399 WP_000804328.1.68476 WP_000804328.1.68479 WP_000804328.1.68504 WP_000804328.1.68512 WP_000804328.1.68548 WP_000804328.1.686 WP_000804328.1.68681 WP_000804328.1.68683 WP_000804328.1.68741 WP_000804328.1.68743 WP_000804328.1.68883 WP_000804328.1.68998 WP_000804328.1.69012 WP_000804328.1.69071 WP_000804328.1.69078 WP_000804328.1.69105 WP_000804328.1.6915 WP_000804328.1.69198 WP_000804328.1.69213 WP_000804328.1.69349 WP_000804328.1.69394 WP_000804328.1.69437 WP_000804328.1.69475 WP_000804328.1.69490 WP_000804328.1.69546 WP_000804328.1.69598 WP_000804328.1.6968 WP_000804328.1.69683 WP_000804328.1.69724 WP_000804328.1.69734 WP_000804328.1.6980 WP_000804328.1.69820 WP_000804328.1.69823 WP_000804328.1.69830 WP_000804328.1.69882 WP_000804328.1.699 WP_000804328.1.69902 WP_000804328.1.69934 WP_000804328.1.69980 WP_000804328.1.69995 WP_000804328.1.70059 WP_000804328.1.70161 WP_000804328.1.70220 WP_000804328.1.70225 WP_000804328.1.70228 WP_000804328.1.70294 WP_000804328.1.70311 WP_000804328.1.70313 WP_000804328.1.70334 WP_000804328.1.70448 WP_000804328.1.7046 WP_000804328.1.70487 WP_000804328.1.70495 WP_000804328.1.70527 WP_000804328.1.70554 WP_000804328.1.70558 WP_000804328.1.70564 WP_000804328.1.7064 WP_000804328.1.70664 WP_000804328.1.707 WP_000804328.1.70721 WP_000804328.1.70763 WP_000804328.1.70808 WP_000804328.1.70835 WP_000804328.1.70843 WP_000804328.1.70909 WP_000804328.1.70926 WP_000804328.1.710 WP_000804328.1.71016 WP_000804328.1.7105 WP_000804328.1.71208 WP_000804328.1.71231 WP_000804328.1.71267 WP_000804328.1.71313 WP_000804328.1.71410 WP_000804328.1.71467 WP_000804328.1.71475 WP_000804328.1.71721 WP_000804328.1.71737 WP_000804328.1.71739 WP_000804328.1.71741 WP_000804328.1.71863 WP_000804328.1.71877 WP_000804328.1.71892 WP_000804328.1.71899 WP_000804328.1.71910 WP_000804328.1.71978 WP_000804328.1.72002 WP_000804328.1.72018 WP_000804328.1.72085 WP_000804328.1.72148 WP_000804328.1.722 WP_000804328.1.72204 WP_000804328.1.72306 WP_000804328.1.72340 WP_000804328.1.72363 WP_000804328.1.72371 WP_000804328.1.72453 WP_000804328.1.72465 WP_000804328.1.72497 WP_000804328.1.7254 WP_000804328.1.7260 WP_000804328.1.72649 WP_000804328.1.72666 WP_000804328.1.72708 WP_000804328.1.72719 WP_000804328.1.72753 WP_000804328.1.72762 WP_000804328.1.72881 WP_000804328.1.72930 WP_000804328.1.72961 WP_000804328.1.72991 WP_000804328.1.73002 WP_000804328.1.73021 WP_000804328.1.73087 WP_000804328.1.73140 WP_000804328.1.73190 WP_000804328.1.73195 WP_000804328.1.73201 WP_000804328.1.73211 WP_000804328.1.73240 WP_000804328.1.73241 WP_000804328.1.73264 WP_000804328.1.73401 WP_000804328.1.73420 WP_000804328.1.73450 WP_000804328.1.73464 WP_000804328.1.73513 WP_000804328.1.73539 WP_000804328.1.7360 WP_000804328.1.73610 WP_000804328.1.7365 WP_000804328.1.73674 WP_000804328.1.73694 WP_000804328.1.73740 WP_000804328.1.73789 WP_000804328.1.73885 WP_000804328.1.73900 WP_000804328.1.73921 WP_000804328.1.73940 WP_000804328.1.73949 WP_000804328.1.73971 WP_000804328.1.74004 WP_000804328.1.7401 WP_000804328.1.7406 WP_000804328.1.74073 WP_000804328.1.74085 WP_000804328.1.74257 WP_000804328.1.74284 WP_000804328.1.74295 WP_000804328.1.74327 WP_000804328.1.74456 WP_000804328.1.74468 WP_000804328.1.74576 WP_000804328.1.74676 WP_000804328.1.74681 WP_000804328.1.74758 WP_000804328.1.74770 WP_000804328.1.74785 WP_000804328.1.74797 WP_000804328.1.7482 WP_000804328.1.74874 WP_000804328.1.75070 WP_000804328.1.75111 WP_000804328.1.75131 WP_000804328.1.75132 WP_000804328.1.75323 WP_000804328.1.75351 WP_000804328.1.75356 WP_000804328.1.75409 WP_000804328.1.75538 WP_000804328.1.75566 WP_000804328.1.75571 WP_000804328.1.75692 WP_000804328.1.75728 WP_000804328.1.75743 WP_000804328.1.75800 WP_000804328.1.75809 WP_000804328.1.75840 WP_000804328.1.75862 WP_000804328.1.75910 WP_000804328.1.76013 WP_000804328.1.7602 WP_000804328.1.76047 WP_000804328.1.76049 WP_000804328.1.76050 WP_000804328.1.76053 WP_000804328.1.76111 WP_000804328.1.76114 WP_000804328.1.76121 WP_000804328.1.76153 WP_000804328.1.76179 WP_000804328.1.7627 WP_000804328.1.76313 WP_000804328.1.76424 WP_000804328.1.76426 WP_000804328.1.76431 WP_000804328.1.76463 WP_000804328.1.76497 WP_000804328.1.76674 WP_000804328.1.76718 WP_000804328.1.76798 WP_000804328.1.76803 WP_000804328.1.76829 WP_000804328.1.7694 WP_000804328.1.77043 WP_000804328.1.77072 WP_000804328.1.77137 WP_000804328.1.77158 WP_000804328.1.77187 WP_000804328.1.77190 WP_000804328.1.77203 WP_000804328.1.77229 WP_000804328.1.77297 WP_000804328.1.77298 WP_000804328.1.77331 WP_000804328.1.77346 WP_000804328.1.77359 WP_000804328.1.77388 WP_000804328.1.77498 WP_000804328.1.77532 WP_000804328.1.77650 WP_000804328.1.77735 WP_000804328.1.77791 WP_000804328.1.7785 WP_000804328.1.7786 WP_000804328.1.77882 WP_000804328.1.77893 WP_000804328.1.77915 WP_000804328.1.77922 WP_000804328.1.77930 WP_000804328.1.77986 WP_000804328.1.78038 WP_000804328.1.78082 WP_000804328.1.78093 WP_000804328.1.78164 WP_000804328.1.78179 WP_000804328.1.78194 WP_000804328.1.78304 WP_000804328.1.78330 WP_000804328.1.78371 WP_000804328.1.78434 WP_000804328.1.78436 WP_000804328.1.78470 WP_000804328.1.78489 WP_000804328.1.78494 WP_000804328.1.7853 WP_000804328.1.78573 WP_000804328.1.78585 WP_000804328.1.78592 WP_000804328.1.78662 WP_000804328.1.78685 WP_000804328.1.78736 WP_000804328.1.78758 WP_000804328.1.78763 WP_000804328.1.78816 WP_000804328.1.78920 WP_000804328.1.78937 WP_000804328.1.78991 WP_000804328.1.78995 WP_000804328.1.7905 WP_000804328.1.79110 WP_000804328.1.7914 WP_000804328.1.79143 WP_000804328.1.79178 WP_000804328.1.79192 WP_000804328.1.79275 WP_000804328.1.79285 WP_000804328.1.79552 WP_000804328.1.79581 WP_000804328.1.79627 WP_000804328.1.79677 WP_000804328.1.79731 WP_000804328.1.79763 WP_000804328.1.7981 WP_000804328.1.79815 WP_000804328.1.79904 WP_000804328.1.80009 WP_000804328.1.80013 WP_000804328.1.80029 WP_000804328.1.80086 WP_000804328.1.80119 WP_000804328.1.80120 WP_000804328.1.80146 WP_000804328.1.80178 WP_000804328.1.80184 WP_000804328.1.80210 WP_000804328.1.80244 WP_000804328.1.80274 WP_000804328.1.80316 WP_000804328.1.80361 WP_000804328.1.80389 WP_000804328.1.8040 WP_000804328.1.80434 WP_000804328.1.8045 WP_000804328.1.80521 WP_000804328.1.80582 WP_000804328.1.80745 WP_000804328.1.80899 WP_000804328.1.81022 WP_000804328.1.81049 WP_000804328.1.81052 WP_000804328.1.81064 WP_000804328.1.81095 WP_000804328.1.81132 WP_000804328.1.81172 WP_000804328.1.81176 WP_000804328.1.81184 WP_000804328.1.81214 WP_000804328.1.81228 WP_000804328.1.81232 WP_000804328.1.81288 WP_000804328.1.81290 WP_000804328.1.81379 WP_000804328.1.81508 WP_000804328.1.81574 WP_000804328.1.8160 WP_000804328.1.81604 WP_000804328.1.81619 WP_000804328.1.8180 WP_000804328.1.81837 WP_000804328.1.81838 WP_000804328.1.8185 WP_000804328.1.81969 WP_000804328.1.81990 WP_000804328.1.8206 WP_000804328.1.82103 WP_000804328.1.8213 WP_000804328.1.82174 WP_000804328.1.82184 WP_000804328.1.82253 WP_000804328.1.82281 WP_000804328.1.82301 WP_000804328.1.82349 WP_000804328.1.82406 WP_000804328.1.82458 WP_000804328.1.82468 WP_000804328.1.82525 WP_000804328.1.82535 WP_000804328.1.82558 WP_000804328.1.8266 WP_000804328.1.82678 WP_000804328.1.82768 WP_000804328.1.82824 WP_000804328.1.82855 WP_000804328.1.82930 WP_000804328.1.82941 WP_000804328.1.83046 WP_000804328.1.83086 WP_000804328.1.83103 WP_000804328.1.8318 WP_000804328.1.83203 WP_000804328.1.83291 WP_000804328.1.83359 WP_000804328.1.83405 WP_000804328.1.83417 WP_000804328.1.8346 WP_000804328.1.83467 WP_000804328.1.83472 WP_000804328.1.83479 WP_000804328.1.83520 WP_000804328.1.83553 WP_000804328.1.8366 WP_000804328.1.83674 WP_000804328.1.83728 WP_000804328.1.83750 WP_000804328.1.83756 WP_000804328.1.83758 WP_000804328.1.83788 WP_000804328.1.83797 WP_000804328.1.83844 WP_000804328.1.8385 WP_000804328.1.83886 WP_000804328.1.83989 WP_000804328.1.84025 WP_000804328.1.84054 WP_000804328.1.84118 WP_000804328.1.84129 WP_000804328.1.84161 WP_000804328.1.84188 WP_000804328.1.84275 WP_000804328.1.84415 WP_000804328.1.84418 WP_000804328.1.84590 WP_000804328.1.84596 WP_000804328.1.84608 WP_000804328.1.8462 WP_000804328.1.84648 WP_000804328.1.84651 WP_000804328.1.84696 WP_000804328.1.84826 WP_000804328.1.84847 WP_000804328.1.84854 WP_000804328.1.84924 WP_000804328.1.8496 WP_000804328.1.84975 WP_000804328.1.84978 WP_000804328.1.85017 WP_000804328.1.85026 WP_000804328.1.85045 WP_000804328.1.85070 WP_000804328.1.85118 WP_000804328.1.85229 WP_000804328.1.85289 WP_000804328.1.85375 WP_000804328.1.85376 WP_000804328.1.85409 WP_000804328.1.85441 WP_000804328.1.85485 WP_000804328.1.85585 WP_000804328.1.85611 WP_000804328.1.85730 WP_000804328.1.85732 WP_000804328.1.85858 WP_000804328.1.85906 WP_000804328.1.85924 WP_000804328.1.85971 WP_000804328.1.85980 WP_000804328.1.86036 WP_000804328.1.86042 WP_000804328.1.86086 WP_000804328.1.862 WP_000804328.1.86209 WP_000804328.1.86281 WP_000804328.1.86315 WP_000804328.1.8636 WP_000804328.1.86363 WP_000804328.1.86390 WP_000804328.1.86473 WP_000804328.1.86531 WP_000804328.1.86664 WP_000804328.1.86704 WP_000804328.1.86736 WP_000804328.1.86745 WP_000804328.1.86779 WP_000804328.1.86793 WP_000804328.1.86795 WP_000804328.1.8690 WP_000804328.1.86968 WP_000804328.1.86999 WP_000804328.1.87088 WP_000804328.1.87097 WP_000804328.1.87100 WP_000804328.1.87133 WP_000804328.1.87137 WP_000804328.1.87168 WP_000804328.1.87190 WP_000804328.1.87204 WP_000804328.1.87221 WP_000804328.1.87296 WP_000804328.1.87363 WP_000804328.1.87372 WP_000804328.1.87388 WP_000804328.1.87486 WP_000804328.1.87511 WP_000804328.1.87541 WP_000804328.1.87595 WP_000804328.1.8764 WP_000804328.1.87734 WP_000804328.1.87854 WP_000804328.1.87865 WP_000804328.1.87937 WP_000804328.1.87967 WP_000804328.1.88169 WP_000804328.1.88309 WP_000804328.1.88375 WP_000804328.1.88418 WP_000804328.1.88430 WP_000804328.1.88440 WP_000804328.1.88449 WP_000804328.1.88563 WP_000804328.1.88585 WP_000804328.1.8859 WP_000804328.1.88600 WP_000804328.1.88614 WP_000804328.1.88696 WP_000804328.1.88771 WP_000804328.1.88781 WP_000804328.1.88843 WP_000804328.1.88878 WP_000804328.1.88954 WP_000804328.1.88960 WP_000804328.1.88962 WP_000804328.1.89012 WP_000804328.1.89024 WP_000804328.1.89036 WP_000804328.1.89125 WP_000804328.1.89164 WP_000804328.1.8918 WP_000804328.1.89184 WP_000804328.1.89262 WP_000804328.1.89290 WP_000804328.1.89348 WP_000804328.1.89350 WP_000804328.1.89390 WP_000804328.1.89404 WP_000804328.1.89433 WP_000804328.1.89779 WP_000804328.1.89794 WP_000804328.1.89863 WP_000804328.1.89949 WP_000804328.1.89950 WP_000804328.1.90069 WP_000804328.1.90173 WP_000804328.1.90174 WP_000804328.1.90217 WP_000804328.1.90246 WP_000804328.1.90250 WP_000804328.1.90386 WP_000804328.1.90447 WP_000804328.1.90454 WP_000804328.1.90475 WP_000804328.1.90488 WP_000804328.1.90506 WP_000804328.1.90533 WP_000804328.1.90556 WP_000804328.1.90661 WP_000804328.1.90698 WP_000804328.1.9076 WP_000804328.1.91005 WP_000804328.1.91019 WP_000804328.1.9122 WP_000804328.1.91280 WP_000804328.1.91287 WP_000804328.1.91447 WP_000804328.1.91486 WP_000804328.1.91525 WP_000804328.1.91530 WP_000804328.1.9155 WP_000804328.1.91586 WP_000804328.1.91634 WP_000804328.1.91670 WP_000804328.1.917 WP_000804328.1.91704 WP_000804328.1.91745 WP_000804328.1.91848 WP_000804328.1.91918 WP_000804328.1.91969 WP_000804328.1.92125 WP_000804328.1.92186 WP_000804328.1.92212 WP_000804328.1.92228 WP_000804328.1.92244 WP_000804328.1.92249 WP_000804328.1.92303 WP_000804328.1.92391 WP_000804328.1.92405 WP_000804328.1.92425 WP_000804328.1.92512 WP_000804328.1.92667 WP_000804328.1.92674 WP_000804328.1.92718 WP_000804328.1.92765 WP_000804328.1.92795 WP_000804328.1.9286 WP_000804328.1.9296 WP_000804328.1.92965 WP_000804328.1.92997 WP_000804328.1.93047 WP_000804328.1.93071 WP_000804328.1.93147 WP_000804328.1.93197 WP_000804328.1.93243 WP_000804328.1.93254 WP_000804328.1.93260 WP_000804328.1.93378 WP_000804328.1.93471 WP_000804328.1.93567 WP_000804328.1.93579 WP_000804328.1.93708 WP_000804328.1.93758 WP_000804328.1.93762 WP_000804328.1.93775 WP_000804328.1.93890 WP_000804328.1.94 WP_000804328.1.94053 WP_000804328.1.94080 WP_000804328.1.94122 WP_000804328.1.94123 WP_000804328.1.94130 WP_000804328.1.94242 WP_000804328.1.94245 WP_000804328.1.94248 WP_000804328.1.94268 WP_000804328.1.94287 WP_000804328.1.94320 WP_000804328.1.94324 WP_000804328.1.94337 WP_000804328.1.94341 WP_000804328.1.94484 WP_000804328.1.94505 WP_000804328.1.94536 WP_000804328.1.9455 WP_000804328.1.947 WP_000804328.1.94825 WP_000804328.1.94969 WP_000804328.1.95008 WP_000804328.1.95023 WP_000804328.1.95029 WP_000804328.1.95033 WP_000804328.1.95156 WP_000804328.1.95193 WP_000804328.1.95263 WP_000804328.1.95281 WP_000804328.1.95294 WP_000804328.1.95386 WP_000804328.1.95415 WP_000804328.1.95494 WP_000804328.1.95512 WP_000804328.1.95519 WP_000804328.1.95522 WP_000804328.1.95560 WP_000804328.1.9563 WP_000804328.1.95683 WP_000804328.1.95780 WP_000804328.1.95804 WP_000804328.1.95832 WP_000804328.1.959 WP_000804328.1.95962 WP_000804328.1.96160 WP_000804328.1.96163 WP_000804328.1.96209 WP_000804328.1.96218 WP_000804328.1.96271 WP_000804328.1.96305 WP_000804328.1.96316 WP_000804328.1.96468 WP_000804328.1.96568 WP_000804328.1.96646 WP_000804328.1.96688 WP_000804328.1.96727 WP_000804328.1.96770 WP_000804328.1.96804 WP_000804328.1.96895 WP_000804328.1.96918 WP_000804328.1.9695 WP_000804328.1.96976 WP_000804328.1.97001 WP_000804328.1.97007 WP_000804328.1.97072 WP_000804328.1.97117 WP_000804328.1.97138 WP_000804328.1.97191 WP_000804328.1.97267 WP_000804328.1.97295 WP_000804328.1.97536 WP_000804328.1.97574 WP_000804328.1.97627 WP_000804328.1.97731 WP_000804328.1.97739 WP_000804328.1.97758 WP_000804328.1.97786 WP_000804328.1.97827 WP_000804328.1.97835 WP_000804328.1.9789 WP_000804328.1.97899 WP_000804328.1.97999 WP_000804328.1.98011 WP_000804328.1.98033 WP_000804328.1.98051 WP_000804328.1.98242 WP_000804328.1.98361 WP_000804328.1.98379 WP_000804328.1.98411 WP_000804328.1.98456 WP_000804328.1.98512 WP_000804328.1.98552 WP_000804328.1.986 WP_000804328.1.98655 WP_000804328.1.98706 WP_000804328.1.98767 WP_000804328.1.98837 WP_000804328.1.98858 WP_000804328.1.98874 WP_000804328.1.98967 WP_000804328.1.99009 WP_000804328.1.99025 WP_000804328.1.99155 WP_000804328.1.99171 WP_000804328.1.99249 WP_000804328.1.99280 WP_000804328.1.99359 WP_000804328.1.99405 WP_000804328.1.99430 WP_000804328.1.99459 WP_000804328.1.99492 WP_000804328.1.99494 WP_000804328.1.99519 WP_000804328.1.99536 WP_000804328.1.99538 WP_000804328.1.99564 WP_000804328.1.99569 WP_000804328.1.9960 WP_000804328.1.99631 WP_000804328.1.99686 WP_000804328.1.99759 WP_000804328.1.99802 WP_000804328.1.99850 WP_000804328.1.99860 WP_000804328.1.9987 WP_000804328.1.99888 WP_000804328.1.99926 WP_000804328.1.99956 WP_000804328.1.99979 WP_000804328.1.99985 YP_499799.1.76163 gi|387142897|ref|YP_005731290.1| gi|151221410|ref|YP_001332232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]