SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspgl1|49751|fgenesh1_kg.17_#_50_#_Locus8999v1rpkm4.19 from Aspergillus glaucus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspgl1|49751|fgenesh1_kg.17_#_50_#_Locus8999v1rpkm4.19
Domain Number 1 Region: 117-479
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 5.1e-96
Family Glutamine synthetase catalytic domain 0.0000359
Further Details:      
 
Domain Number 2 Region: 9-110
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.00000314
Family Glutamine synthetase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspgl1|49751|fgenesh1_kg.17_#_50_#_Locus8999v1rpkm4.19
Sequence length 481
Sequence
MSEVTVDNVAEILQNDSAVKVAGVDVDGQLRGKLMAKKKFLSIVTEGFGFCSVIFGWDMH
DQTYFKELGISNKENGYRDIVAVPDLNSFRRIPWENNVPFFLVSFFDPDTREALFACPRG
LLNTAVSKAEEAGYQAMAGAEYEFYQFRTPGNHPTPERNASSTATFLKENPVEALPPLTE
GMFGYSITRPIHNQDYYYGVFNACESFRCEIEGWHTESGPGVYEAALQFGEAKEMADKAG
LFKYVVKAIGTKHGITPAFMAKPRQGLPGNSGHIHISLMKDGKNAFFRDTPDPSPPYPDV
AHLSDLGRHFLAGVLTGLPDIMPLFAPTINSYKRLVENFWAPVTVSWGLEHRAASVRVIT
PPTASPKATRLEVRVPGADCNPHLALAAIVALGWKGVEKKLEIPVPPLSKGEDMGGASDQ
GARLAKSLKEATVRFTDKDSMAREVFGDAFVEHFGGTREHEVRLWEEAVTDWEVRRYIET
V
Download sequence
Identical sequences A0A1L9VD00
jgi|Aspgl1|49751|fgenesh1_kg.17_#_50_#_Locus8999v1rpkm4.19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]