SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspgl1|68029|fgenesh1_pm.16_#_17 from Aspergillus glaucus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspgl1|68029|fgenesh1_pm.16_#_17
Domain Number 1 Region: 859-1104
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.6e-71
Family Glutamine synthetase catalytic domain 0.003
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.28e-20
Family Glutamine synthetase, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspgl1|68029|fgenesh1_pm.16_#_17
Sequence length 1107
Sequence
MATPSSKPNPGATPTHLTSSPRPSGVPMARPMSHKSPSARSPSASGHFHGGGGGHAPLHQ
YSTPLAVAAAGLDDPVAFSSPSALLALGGYSGISPSPATHEVLAGAGMHDSDIHALGMHG
FKLGNARDSDEERRRHIEDIVQMLRTRVAGRGVCREGIERLGQLEGFESIWQEDNLSIAG
NFVDLEIEFHPGKHTVKDVSLKYATPEATEGEGRDEATAVLKRDLMQSPEEIERGAWKSL
TGFYENLRWLAKLDRLSQEVNCFEAIEGLYESLKRIWDEESKHLKFPEIYEHLCSGWVGR
PSLHRGGRIGISLDYWVYQAKVLDAKRKSTSPDAMVLDNADQEFDDHQHKMWSVMIECEE
GYPSLRVSKDWVNSKVLTATSTDESSAPNENATPDIPMVNWAEPPMTTTSDNQGNPDAMT
LDSGMLGSSTPNRRFVAKIEPPLDIPILAASDIYRQLGLQLPQEFRMVTYDGLLVPGSSP
LSGADIMGFGTDEPPQADRRKRRLSVQALDSEGKPCKKQHGYTFQAFESVAGRTMRDIPF
SHPRQLAEIFPVLRQYATLENMVQKIFYTPSQDHYSKQNGPGSMSLDKKQQAAQSSTTNG
KGDVTILSNQDPNEQKLDALMKGLNVEGTSTNNDADDVKIDITLRTQLGQAPVIMLLFTI
NDASIENDYLNTFSISFEVGLNGHITVVDTSGLWEEPVSGDDRPEGAETGDQKDEASEMP
KKIARALEVSQDLGILVEWVLRWRRQRKSTAETSTVISNTDNLMKYMDLPQRGHIQAEYV
WIDATGGCRCKTKTLSKPITSVDELPEWNFDGSSTGQAGGDNSDVYLRPVAFFPDPFRRG
DNILVLCETWDSDGTPNKFNYRHEANRLMEAHSKEDWWFGLEQEYTLLGTDGWPYGWPKG
GFPGAQGPYYCGVGTGKVYCRDIVEAHFRACLYAGVKISGINAEVMPSQWEYQVGPCNGI
EMGDHLWMSRFFLHRVAEEFGVKISFEPKPVKGEWNGAGLHTNVSTASMRDDGGMKVIEA
AMKKLEARHVEHIAVYGEGNEERLTGRHETGNIDKFSYGVANRGGSIRIPRQCAKDGKGY
FEDRRPASNADPYQITGIIVETLCGGN
Download sequence
Identical sequences A0A1L9VDL2
jgi|Aspgl1|68029|fgenesh1_pm.16_#_17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]