SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspgl1|167730|estExt_Genewise1Plus.C_6_t10256 from Aspergillus glaucus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspgl1|167730|estExt_Genewise1Plus.C_6_t10256
Domain Number 1 Region: 106-444
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 6.08e-62
Family Glutamine synthetase catalytic domain 0.00026
Further Details:      
 
Weak hits

Sequence:  jgi|Aspgl1|167730|estExt_Genewise1Plus.C_6_t10256
Domain Number - Region: 6-102
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000615
Family Glutamine synthetase, N-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspgl1|167730|estExt_Genewise1Plus.C_6_t10256
Sequence length 446
Sequence
MRFLSKNHNVKFVWLQFLPYTTNTYTRIVPVAKFTQMVGNGRRLSIANEAFLLAPGDCLV
DEELAAGSFSLLPDLDTAYCQAHSEGTRVVIQCDCVDSKNGQPIERCARSLTRHLCSKFQ
SSTGLVPYIGFEVEVVFMKREPDTVTYTPISRNHQWSGITQEDSVHLNLIEGCMSALEMV
GVAVEHVHAEAAPGQWEFVLSPDWPLPAIDALLKARDTTRIVARLFDVHATWHPRLWPDH
PGTGVHVHMSLYDPWKGQEPRRDTHYIKKFQHFMAGVLQHILAIMAFSLPQEVSYERVKP
GIWSGGEYACWGLDNKETPLCLIEENHLELRMIDRLANPYLVFCAMLKAGEYGIERQMSL
VAGQVETAPAKLPPTKRDDLMLLPKTLQGSLKALEIDPILDQYTPNVIGDHPMAMVRTYI
AVKREEAEILQKMEPDERRAWLISRY
Download sequence
Identical sequences A0A1L9VPV7
jgi|Aspgl1|167730|estExt_Genewise1Plus.C_6_t10256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]