SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387617869|ref|YP_006120891.1| from Escherichia coli O83:H1 str. NRG 857C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387617869|ref|YP_006120891.1|
Domain Number 1 Region: 6-157
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.01e-59
Family Deoxycytidylate deaminase-like 0.0000000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387617869|ref|YP_006120891.1|
Sequence length 167
Comment tRNA-specific adenosine deaminase [Escherichia coli O83:H1 str. NRG 857C]
Sequence
MSEVEFSHEYWMRHAMTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEI
MALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDV
LHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD
Download sequence
Identical sequences A0A024KYI4 A0A025CD79 A0A029HRL7 A0A029IMA3 A0A067HDL0 A0A070UYX4 A0A080IRI6 A0A0E2L3C3 A0A0F6FAS8 A0A0H3ELB8 A0A181WNI4 A0A1E2VJY7 A0A1E3N2K5 A0A2H1BIG8 B7UGZ9 E7SY55 E9YR79 F3V8K1 F3WKV1 H4IED4 H4IVD7 H4JBB4 H4KK82 H4LFD6 I6D7Y5 L3C4J5 L3P7J0 L4J2U3 L4V7J3 M9H2R5 Q8FF24 Q8XA44 S0XZP6 S0YXM0 S1PEW3 T6H782 T6LU72 T9S8N5
gi|387617869|ref|YP_006120891.1| gi|544577028|ref|YP_008572552.1| 444450.ECH74115_3793 544404.ECSP_3503 574521.E2348C_2836 gi|209400171|ref|YP_002272033.1| gi|215487903|ref|YP_002330334.1| gi|254794508|ref|YP_003079345.1| NP_311452.2.58667 YP_006120891.1.29421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]