SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387619211|ref|YP_006122233.1| from Escherichia coli O83:H1 str. NRG 857C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387619211|ref|YP_006122233.1|
Domain Number 1 Region: 22-275
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.53e-81
Family FdhD/NarQ 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387619211|ref|YP_006122233.1|
Sequence length 277
Comment formate dehydrogenase accessory protein [Escherichia coli O83:H1 str. NRG 857C]
Sequence
MKKTQQKEIENVTNITGVRQIELWRRDDLQHPRLDEVAEEVPVALVYNGISHVVMMASPK
DLEYFALGFSLSEGIIESPRDIFGMDVVPSCNGLEVQIELSSRRFMGLKERRRALAGRTG
CGVCGVEQLNDIGKPVQPLPFTQMFDLNKLDDALRHLNDFQPVGQLTGCTHAAAWMLPSG
ELVGGHEDVGRHVALDKLLGRRSQEGESWQQGAVLVSSRASYEMVQKSAMCGVEILFAVS
AATTLAVEVAERCNLTLVGFCKPGRATVYTHPQRLSN
Download sequence
Identical sequences A0A0H3ESC3 A0A0V9RM26 Q8FBE5 T6GHT0
gi|222158606|ref|YP_002558745.1| 199310.c4847 WP_000753585.1.100151 WP_000753585.1.100306 WP_000753585.1.100959 WP_000753585.1.10138 WP_000753585.1.101586 WP_000753585.1.101693 WP_000753585.1.101700 WP_000753585.1.101984 WP_000753585.1.102076 WP_000753585.1.102106 WP_000753585.1.10786 WP_000753585.1.10869 WP_000753585.1.11285 WP_000753585.1.11411 WP_000753585.1.11519 WP_000753585.1.11575 WP_000753585.1.12174 WP_000753585.1.12268 WP_000753585.1.12295 WP_000753585.1.1278 WP_000753585.1.12826 WP_000753585.1.12917 WP_000753585.1.13181 WP_000753585.1.13272 WP_000753585.1.13626 WP_000753585.1.13778 WP_000753585.1.14023 WP_000753585.1.14245 WP_000753585.1.14371 WP_000753585.1.16131 WP_000753585.1.16705 WP_000753585.1.16927 WP_000753585.1.17028 WP_000753585.1.17325 WP_000753585.1.17849 WP_000753585.1.18121 WP_000753585.1.18908 WP_000753585.1.19036 WP_000753585.1.19171 WP_000753585.1.19492 WP_000753585.1.1960 WP_000753585.1.19654 WP_000753585.1.19761 WP_000753585.1.19972 WP_000753585.1.20224 WP_000753585.1.20565 WP_000753585.1.20818 WP_000753585.1.20962 WP_000753585.1.21614 WP_000753585.1.21652 WP_000753585.1.21773 WP_000753585.1.22088 WP_000753585.1.22293 WP_000753585.1.22667 WP_000753585.1.23021 WP_000753585.1.23282 WP_000753585.1.23435 WP_000753585.1.23686 WP_000753585.1.23700 WP_000753585.1.24177 WP_000753585.1.24797 WP_000753585.1.2502 WP_000753585.1.25612 WP_000753585.1.25680 WP_000753585.1.26131 WP_000753585.1.26284 WP_000753585.1.26398 WP_000753585.1.26579 WP_000753585.1.26837 WP_000753585.1.2700 WP_000753585.1.27520 WP_000753585.1.27871 WP_000753585.1.28199 WP_000753585.1.28345 WP_000753585.1.28500 WP_000753585.1.28723 WP_000753585.1.28924 WP_000753585.1.29258 WP_000753585.1.2963 WP_000753585.1.29647 WP_000753585.1.29819 WP_000753585.1.29855 WP_000753585.1.30400 WP_000753585.1.309 WP_000753585.1.32478 WP_000753585.1.32650 WP_000753585.1.32748 WP_000753585.1.32938 WP_000753585.1.33352 WP_000753585.1.34208 WP_000753585.1.34294 WP_000753585.1.34362 WP_000753585.1.35107 WP_000753585.1.35127 WP_000753585.1.35208 WP_000753585.1.35394 WP_000753585.1.35483 WP_000753585.1.35578 WP_000753585.1.35632 WP_000753585.1.35741 WP_000753585.1.35889 WP_000753585.1.36459 WP_000753585.1.37032 WP_000753585.1.37226 WP_000753585.1.37477 WP_000753585.1.39313 WP_000753585.1.39377 WP_000753585.1.39651 WP_000753585.1.39734 WP_000753585.1.40019 WP_000753585.1.40349 WP_000753585.1.40486 WP_000753585.1.40843 WP_000753585.1.41041 WP_000753585.1.41063 WP_000753585.1.41078 WP_000753585.1.41332 WP_000753585.1.42191 WP_000753585.1.42600 WP_000753585.1.43427 WP_000753585.1.44327 WP_000753585.1.4459 WP_000753585.1.44717 WP_000753585.1.44836 WP_000753585.1.45190 WP_000753585.1.4530 WP_000753585.1.45525 WP_000753585.1.4576 WP_000753585.1.45789 WP_000753585.1.45801 WP_000753585.1.45891 WP_000753585.1.4610 WP_000753585.1.46438 WP_000753585.1.46795 WP_000753585.1.47047 WP_000753585.1.47124 WP_000753585.1.47189 WP_000753585.1.47235 WP_000753585.1.47366 WP_000753585.1.47454 WP_000753585.1.48431 WP_000753585.1.49170 WP_000753585.1.49179 WP_000753585.1.49412 WP_000753585.1.49483 WP_000753585.1.50228 WP_000753585.1.50925 WP_000753585.1.511 WP_000753585.1.51426 WP_000753585.1.52085 WP_000753585.1.52542 WP_000753585.1.53021 WP_000753585.1.54188 WP_000753585.1.54208 WP_000753585.1.5434 WP_000753585.1.54524 WP_000753585.1.54534 WP_000753585.1.54590 WP_000753585.1.54754 WP_000753585.1.5478 WP_000753585.1.55731 WP_000753585.1.55790 WP_000753585.1.55808 WP_000753585.1.55896 WP_000753585.1.56122 WP_000753585.1.56941 WP_000753585.1.57608 WP_000753585.1.57832 WP_000753585.1.58092 WP_000753585.1.58345 WP_000753585.1.585 WP_000753585.1.58737 WP_000753585.1.59060 WP_000753585.1.59483 WP_000753585.1.59815 WP_000753585.1.59970 WP_000753585.1.615 WP_000753585.1.62043 WP_000753585.1.62091 WP_000753585.1.62262 WP_000753585.1.62586 WP_000753585.1.63305 WP_000753585.1.63310 WP_000753585.1.63419 WP_000753585.1.63465 WP_000753585.1.64180 WP_000753585.1.643 WP_000753585.1.64712 WP_000753585.1.6500 WP_000753585.1.65104 WP_000753585.1.6527 WP_000753585.1.65957 WP_000753585.1.66421 WP_000753585.1.6666 WP_000753585.1.66706 WP_000753585.1.67047 WP_000753585.1.67132 WP_000753585.1.67164 WP_000753585.1.68052 WP_000753585.1.68279 WP_000753585.1.68793 WP_000753585.1.69382 WP_000753585.1.69450 WP_000753585.1.69506 WP_000753585.1.697 WP_000753585.1.69832 WP_000753585.1.69963 WP_000753585.1.701 WP_000753585.1.7015 WP_000753585.1.70230 WP_000753585.1.70337 WP_000753585.1.71287 WP_000753585.1.71967 WP_000753585.1.72117 WP_000753585.1.72290 WP_000753585.1.72298 WP_000753585.1.723 WP_000753585.1.72425 WP_000753585.1.72599 WP_000753585.1.73333 WP_000753585.1.74032 WP_000753585.1.74041 WP_000753585.1.74185 WP_000753585.1.74358 WP_000753585.1.74915 WP_000753585.1.75087 WP_000753585.1.75228 WP_000753585.1.75557 WP_000753585.1.76268 WP_000753585.1.76269 WP_000753585.1.76469 WP_000753585.1.76504 WP_000753585.1.76660 WP_000753585.1.7689 WP_000753585.1.76961 WP_000753585.1.77036 WP_000753585.1.77487 WP_000753585.1.77643 WP_000753585.1.77816 WP_000753585.1.78232 WP_000753585.1.78512 WP_000753585.1.78689 WP_000753585.1.78955 WP_000753585.1.79001 WP_000753585.1.79100 WP_000753585.1.79348 WP_000753585.1.79409 WP_000753585.1.7967 WP_000753585.1.80063 WP_000753585.1.80660 WP_000753585.1.80948 WP_000753585.1.81266 WP_000753585.1.81323 WP_000753585.1.814 WP_000753585.1.82104 WP_000753585.1.82221 WP_000753585.1.82539 WP_000753585.1.83125 WP_000753585.1.83256 WP_000753585.1.83644 WP_000753585.1.83911 WP_000753585.1.8405 WP_000753585.1.84059 WP_000753585.1.84486 WP_000753585.1.85025 WP_000753585.1.85125 WP_000753585.1.85252 WP_000753585.1.85384 WP_000753585.1.85578 WP_000753585.1.85593 WP_000753585.1.86273 WP_000753585.1.8656 WP_000753585.1.86560 WP_000753585.1.86613 WP_000753585.1.87074 WP_000753585.1.87766 WP_000753585.1.88082 WP_000753585.1.88767 WP_000753585.1.88793 WP_000753585.1.88826 WP_000753585.1.89043 WP_000753585.1.89285 WP_000753585.1.89396 WP_000753585.1.89469 WP_000753585.1.902 WP_000753585.1.90346 WP_000753585.1.90357 WP_000753585.1.90775 WP_000753585.1.9087 WP_000753585.1.90905 WP_000753585.1.90996 WP_000753585.1.91182 WP_000753585.1.91566 WP_000753585.1.91756 WP_000753585.1.91893 WP_000753585.1.91954 WP_000753585.1.92025 WP_000753585.1.9209 WP_000753585.1.92767 WP_000753585.1.93139 WP_000753585.1.93461 WP_000753585.1.93639 WP_000753585.1.93765 WP_000753585.1.94040 WP_000753585.1.94438 WP_000753585.1.9474 WP_000753585.1.94869 WP_000753585.1.95084 WP_000753585.1.95364 WP_000753585.1.95398 WP_000753585.1.95449 WP_000753585.1.95628 WP_000753585.1.96558 WP_000753585.1.96762 WP_000753585.1.9682 WP_000753585.1.97292 WP_000753585.1.99060 WP_000753585.1.99472 WP_000753585.1.99571 WP_000753585.1.99694 YP_006122233.1.29421 gi|386636783|ref|YP_006156502.1| gi|387619211|ref|YP_006122233.1| gi|26250661|ref|NP_756701.1| gi|386631863|ref|YP_006151583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]