SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387830977|ref|YP_003350914.1| from Escherichia coli SE15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387830977|ref|YP_003350914.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.35e-109
Family FMN-linked oxidoreductases 0.0000000000112
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 6.24e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000003
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.97e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387830977|ref|YP_003350914.1|
Sequence length 672
Comment putative 2,4-dieonyl-CoA reductase [Escherichia coli SE15]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDANQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEGGGTFAEMVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A066STI1 A0A192CCQ7 F4T3A6 W9AKC9
gi|556552999|ref|YP_008723463.1| WP_000121413.1.100014 WP_000121413.1.100227 WP_000121413.1.100281 WP_000121413.1.100304 WP_000121413.1.101087 WP_000121413.1.101148 WP_000121413.1.101399 WP_000121413.1.10181 WP_000121413.1.101855 WP_000121413.1.101932 WP_000121413.1.102104 WP_000121413.1.10842 WP_000121413.1.10849 WP_000121413.1.11315 WP_000121413.1.11607 WP_000121413.1.11612 WP_000121413.1.12088 WP_000121413.1.12151 WP_000121413.1.12830 WP_000121413.1.12956 WP_000121413.1.12976 WP_000121413.1.12991 WP_000121413.1.13117 WP_000121413.1.13934 WP_000121413.1.14581 WP_000121413.1.14807 WP_000121413.1.15654 WP_000121413.1.15863 WP_000121413.1.1604 WP_000121413.1.16067 WP_000121413.1.16396 WP_000121413.1.16807 WP_000121413.1.17014 WP_000121413.1.17206 WP_000121413.1.17925 WP_000121413.1.18024 WP_000121413.1.18337 WP_000121413.1.18348 WP_000121413.1.18394 WP_000121413.1.18556 WP_000121413.1.19153 WP_000121413.1.19245 WP_000121413.1.19547 WP_000121413.1.19593 WP_000121413.1.20238 WP_000121413.1.20575 WP_000121413.1.20741 WP_000121413.1.21152 WP_000121413.1.21236 WP_000121413.1.21266 WP_000121413.1.21378 WP_000121413.1.21455 WP_000121413.1.21537 WP_000121413.1.22161 WP_000121413.1.22203 WP_000121413.1.22272 WP_000121413.1.2242 WP_000121413.1.22464 WP_000121413.1.22576 WP_000121413.1.22824 WP_000121413.1.22917 WP_000121413.1.22993 WP_000121413.1.23021 WP_000121413.1.23109 WP_000121413.1.23522 WP_000121413.1.23840 WP_000121413.1.23890 WP_000121413.1.24004 WP_000121413.1.24127 WP_000121413.1.2449 WP_000121413.1.2469 WP_000121413.1.24773 WP_000121413.1.24906 WP_000121413.1.24979 WP_000121413.1.25380 WP_000121413.1.25420 WP_000121413.1.25446 WP_000121413.1.25480 WP_000121413.1.2567 WP_000121413.1.25701 WP_000121413.1.25869 WP_000121413.1.25873 WP_000121413.1.25895 WP_000121413.1.26076 WP_000121413.1.26189 WP_000121413.1.26259 WP_000121413.1.26304 WP_000121413.1.26950 WP_000121413.1.26987 WP_000121413.1.26995 WP_000121413.1.27043 WP_000121413.1.27091 WP_000121413.1.27401 WP_000121413.1.27618 WP_000121413.1.2779 WP_000121413.1.27913 WP_000121413.1.27998 WP_000121413.1.28026 WP_000121413.1.28156 WP_000121413.1.28349 WP_000121413.1.28461 WP_000121413.1.28476 WP_000121413.1.28742 WP_000121413.1.30063 WP_000121413.1.3018 WP_000121413.1.30239 WP_000121413.1.30665 WP_000121413.1.30867 WP_000121413.1.30879 WP_000121413.1.31017 WP_000121413.1.3147 WP_000121413.1.31511 WP_000121413.1.31557 WP_000121413.1.31596 WP_000121413.1.32021 WP_000121413.1.32225 WP_000121413.1.32432 WP_000121413.1.3259 WP_000121413.1.3269 WP_000121413.1.33303 WP_000121413.1.3344 WP_000121413.1.34121 WP_000121413.1.34528 WP_000121413.1.3460 WP_000121413.1.34875 WP_000121413.1.34887 WP_000121413.1.34931 WP_000121413.1.35007 WP_000121413.1.35198 WP_000121413.1.35258 WP_000121413.1.35627 WP_000121413.1.35963 WP_000121413.1.35987 WP_000121413.1.36405 WP_000121413.1.3643 WP_000121413.1.36761 WP_000121413.1.3697 WP_000121413.1.37306 WP_000121413.1.37342 WP_000121413.1.37423 WP_000121413.1.37544 WP_000121413.1.37550 WP_000121413.1.37984 WP_000121413.1.37998 WP_000121413.1.38000 WP_000121413.1.38300 WP_000121413.1.38561 WP_000121413.1.39232 WP_000121413.1.39289 WP_000121413.1.39325 WP_000121413.1.39401 WP_000121413.1.39713 WP_000121413.1.39809 WP_000121413.1.39867 WP_000121413.1.40107 WP_000121413.1.40300 WP_000121413.1.40345 WP_000121413.1.40360 WP_000121413.1.40560 WP_000121413.1.40607 WP_000121413.1.40657 WP_000121413.1.40660 WP_000121413.1.40715 WP_000121413.1.41453 WP_000121413.1.41482 WP_000121413.1.41990 WP_000121413.1.42597 WP_000121413.1.42601 WP_000121413.1.42638 WP_000121413.1.43278 WP_000121413.1.4343 WP_000121413.1.44263 WP_000121413.1.45405 WP_000121413.1.45627 WP_000121413.1.45676 WP_000121413.1.4583 WP_000121413.1.46164 WP_000121413.1.46291 WP_000121413.1.46806 WP_000121413.1.4725 WP_000121413.1.4783 WP_000121413.1.47935 WP_000121413.1.48051 WP_000121413.1.4826 WP_000121413.1.48317 WP_000121413.1.48469 WP_000121413.1.48827 WP_000121413.1.49001 WP_000121413.1.49347 WP_000121413.1.49521 WP_000121413.1.49594 WP_000121413.1.49615 WP_000121413.1.49625 WP_000121413.1.49783 WP_000121413.1.49884 WP_000121413.1.49972 WP_000121413.1.50058 WP_000121413.1.50690 WP_000121413.1.50988 WP_000121413.1.50990 WP_000121413.1.51170 WP_000121413.1.51180 WP_000121413.1.51190 WP_000121413.1.51211 WP_000121413.1.5124 WP_000121413.1.51253 WP_000121413.1.51392 WP_000121413.1.52048 WP_000121413.1.52098 WP_000121413.1.53162 WP_000121413.1.53415 WP_000121413.1.5391 WP_000121413.1.53940 WP_000121413.1.54095 WP_000121413.1.54418 WP_000121413.1.54439 WP_000121413.1.55149 WP_000121413.1.55981 WP_000121413.1.56033 WP_000121413.1.56040 WP_000121413.1.56139 WP_000121413.1.56142 WP_000121413.1.56278 WP_000121413.1.5632 WP_000121413.1.56338 WP_000121413.1.56402 WP_000121413.1.56457 WP_000121413.1.56821 WP_000121413.1.56933 WP_000121413.1.56936 WP_000121413.1.57278 WP_000121413.1.57451 WP_000121413.1.58094 WP_000121413.1.58449 WP_000121413.1.58552 WP_000121413.1.58609 WP_000121413.1.59073 WP_000121413.1.5942 WP_000121413.1.59426 WP_000121413.1.59572 WP_000121413.1.59660 WP_000121413.1.59745 WP_000121413.1.60133 WP_000121413.1.60235 WP_000121413.1.60373 WP_000121413.1.61245 WP_000121413.1.61445 WP_000121413.1.61789 WP_000121413.1.62102 WP_000121413.1.62454 WP_000121413.1.62784 WP_000121413.1.62788 WP_000121413.1.63285 WP_000121413.1.64053 WP_000121413.1.64417 WP_000121413.1.65114 WP_000121413.1.65116 WP_000121413.1.65286 WP_000121413.1.66017 WP_000121413.1.66044 WP_000121413.1.6618 WP_000121413.1.66290 WP_000121413.1.66295 WP_000121413.1.6698 WP_000121413.1.67153 WP_000121413.1.67174 WP_000121413.1.67258 WP_000121413.1.67427 WP_000121413.1.67464 WP_000121413.1.67606 WP_000121413.1.67690 WP_000121413.1.67737 WP_000121413.1.68157 WP_000121413.1.68177 WP_000121413.1.68362 WP_000121413.1.68524 WP_000121413.1.68572 WP_000121413.1.68795 WP_000121413.1.68847 WP_000121413.1.68952 WP_000121413.1.68995 WP_000121413.1.69643 WP_000121413.1.69716 WP_000121413.1.69831 WP_000121413.1.7001 WP_000121413.1.7050 WP_000121413.1.71139 WP_000121413.1.7121 WP_000121413.1.71294 WP_000121413.1.71311 WP_000121413.1.71563 WP_000121413.1.71732 WP_000121413.1.71855 WP_000121413.1.72028 WP_000121413.1.72212 WP_000121413.1.72359 WP_000121413.1.72388 WP_000121413.1.72469 WP_000121413.1.72700 WP_000121413.1.7281 WP_000121413.1.73215 WP_000121413.1.73291 WP_000121413.1.73344 WP_000121413.1.73486 WP_000121413.1.74682 WP_000121413.1.75100 WP_000121413.1.75419 WP_000121413.1.75808 WP_000121413.1.76030 WP_000121413.1.7613 WP_000121413.1.76469 WP_000121413.1.771 WP_000121413.1.77200 WP_000121413.1.77224 WP_000121413.1.7775 WP_000121413.1.7780 WP_000121413.1.78010 WP_000121413.1.78305 WP_000121413.1.78491 WP_000121413.1.78575 WP_000121413.1.78814 WP_000121413.1.78845 WP_000121413.1.78893 WP_000121413.1.79243 WP_000121413.1.79276 WP_000121413.1.79619 WP_000121413.1.79933 WP_000121413.1.79973 WP_000121413.1.80 WP_000121413.1.80026 WP_000121413.1.80096 WP_000121413.1.80392 WP_000121413.1.81032 WP_000121413.1.81056 WP_000121413.1.81120 WP_000121413.1.81141 WP_000121413.1.81588 WP_000121413.1.82106 WP_000121413.1.8255 WP_000121413.1.82747 WP_000121413.1.82816 WP_000121413.1.83059 WP_000121413.1.83118 WP_000121413.1.83127 WP_000121413.1.83253 WP_000121413.1.83911 WP_000121413.1.84215 WP_000121413.1.84316 WP_000121413.1.84464 WP_000121413.1.8447 WP_000121413.1.84531 WP_000121413.1.84639 WP_000121413.1.85138 WP_000121413.1.85329 WP_000121413.1.85623 WP_000121413.1.86104 WP_000121413.1.86179 WP_000121413.1.86673 WP_000121413.1.86727 WP_000121413.1.87043 WP_000121413.1.87371 WP_000121413.1.87633 WP_000121413.1.8778 WP_000121413.1.87883 WP_000121413.1.88119 WP_000121413.1.8822 WP_000121413.1.88336 WP_000121413.1.88499 WP_000121413.1.8855 WP_000121413.1.88752 WP_000121413.1.89203 WP_000121413.1.89879 WP_000121413.1.89917 WP_000121413.1.90050 WP_000121413.1.909 WP_000121413.1.90988 WP_000121413.1.91143 WP_000121413.1.91354 WP_000121413.1.92384 WP_000121413.1.93017 WP_000121413.1.93138 WP_000121413.1.93464 WP_000121413.1.93922 WP_000121413.1.94028 WP_000121413.1.94892 WP_000121413.1.94955 WP_000121413.1.94997 WP_000121413.1.95105 WP_000121413.1.95329 WP_000121413.1.95366 WP_000121413.1.95378 WP_000121413.1.95428 WP_000121413.1.9566 WP_000121413.1.95666 WP_000121413.1.95783 WP_000121413.1.95929 WP_000121413.1.96145 WP_000121413.1.96223 WP_000121413.1.9641 WP_000121413.1.9671 WP_000121413.1.97147 WP_000121413.1.97226 WP_000121413.1.97823 WP_000121413.1.98480 WP_000121413.1.98633 WP_000121413.1.99307 WP_000121413.1.99498 gi|386620708|ref|YP_006140288.1| gi|387830977|ref|YP_003350914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]