SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|476420920|ref|YP_007571916.1| from Streptococcus suis SC070731

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|476420920|ref|YP_007571916.1|
Domain Number 1 Region: 57-149
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 8.5e-24
Family Ribosomal protein L9 C-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000000262
Family Ribosomal protein L9 N-domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|476420920|ref|YP_007571916.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Streptococcus suis SC070731]
Sequence
MKVIFLADVKGQGKKGEIKEVPTGYAQNFLIKKNLAKEATNQAISALRGQEKSKEKAHAE
MIAEAEAIKAKLAEEATLVKFVEKVGPDGRTFGSITSKKIAEELDKQFGIKIDKRHIQLD
HPIRAIGLIDVPVKIYQDVTGIINLSIKEA
Download sequence
Identical sequences A0A0H3N2E7 A0A0Z9HJI6 G7SKJ8 U5ULT3
gi|386589224|ref|YP_006085625.1| gi|253752792|ref|YP_003025933.1| gi|403062556|ref|YP_006650772.1| gi|499144231|ref|YP_007976295.1| gi|253756550|ref|YP_003029690.1| gi|476420920|ref|YP_007571916.1| 218494.SSU1939 568813.SSUSC84_1957 568814.SSUBM407_2004 gi|386581018|ref|YP_006077423.1| gi|389857664|ref|YP_006359907.1| gi|556589767|ref|YP_008757321.1| WP_012775408.1.10007 WP_012775408.1.100280 WP_012775408.1.100404 WP_012775408.1.100490 WP_012775408.1.100670 WP_012775408.1.100701 WP_012775408.1.100904 WP_012775408.1.100908 WP_012775408.1.101097 WP_012775408.1.101179 WP_012775408.1.101295 WP_012775408.1.10137 WP_012775408.1.101447 WP_012775408.1.101621 WP_012775408.1.101658 WP_012775408.1.101706 WP_012775408.1.101901 WP_012775408.1.102038 WP_012775408.1.10265 WP_012775408.1.1035 WP_012775408.1.10700 WP_012775408.1.10896 WP_012775408.1.11017 WP_012775408.1.11330 WP_012775408.1.11527 WP_012775408.1.11548 WP_012775408.1.11662 WP_012775408.1.11845 WP_012775408.1.11869 WP_012775408.1.11874 WP_012775408.1.11918 WP_012775408.1.1200 WP_012775408.1.12022 WP_012775408.1.12228 WP_012775408.1.12288 WP_012775408.1.12368 WP_012775408.1.1244 WP_012775408.1.12606 WP_012775408.1.12665 WP_012775408.1.12803 WP_012775408.1.13051 WP_012775408.1.13095 WP_012775408.1.13153 WP_012775408.1.1324 WP_012775408.1.13380 WP_012775408.1.13633 WP_012775408.1.13861 WP_012775408.1.1405 WP_012775408.1.14202 WP_012775408.1.14210 WP_012775408.1.1424 WP_012775408.1.1434 WP_012775408.1.14359 WP_012775408.1.1495 WP_012775408.1.15112 WP_012775408.1.1537 WP_012775408.1.15393 WP_012775408.1.15414 WP_012775408.1.15545 WP_012775408.1.15756 WP_012775408.1.15813 WP_012775408.1.1616 WP_012775408.1.16193 WP_012775408.1.16255 WP_012775408.1.16271 WP_012775408.1.1629 WP_012775408.1.16498 WP_012775408.1.16643 WP_012775408.1.16677 WP_012775408.1.16683 WP_012775408.1.16773 WP_012775408.1.16829 WP_012775408.1.16881 WP_012775408.1.17191 WP_012775408.1.17264 WP_012775408.1.17388 WP_012775408.1.17663 WP_012775408.1.17670 WP_012775408.1.17749 WP_012775408.1.17814 WP_012775408.1.17958 WP_012775408.1.17989 WP_012775408.1.18076 WP_012775408.1.1810 WP_012775408.1.18271 WP_012775408.1.18341 WP_012775408.1.18403 WP_012775408.1.18563 WP_012775408.1.18711 WP_012775408.1.18850 WP_012775408.1.19016 WP_012775408.1.19145 WP_012775408.1.19352 WP_012775408.1.19378 WP_012775408.1.19521 WP_012775408.1.1953 WP_012775408.1.19865 WP_012775408.1.19898 WP_012775408.1.1991 WP_012775408.1.19935 WP_012775408.1.20400 WP_012775408.1.20518 WP_012775408.1.20584 WP_012775408.1.20756 WP_012775408.1.20792 WP_012775408.1.20819 WP_012775408.1.20944 WP_012775408.1.21072 WP_012775408.1.21347 WP_012775408.1.21348 WP_012775408.1.21374 WP_012775408.1.21457 WP_012775408.1.21688 WP_012775408.1.21903 WP_012775408.1.21994 WP_012775408.1.22347 WP_012775408.1.22560 WP_012775408.1.22785 WP_012775408.1.22805 WP_012775408.1.22848 WP_012775408.1.22882 WP_012775408.1.23089 WP_012775408.1.23273 WP_012775408.1.23317 WP_012775408.1.23358 WP_012775408.1.23682 WP_012775408.1.23965 WP_012775408.1.24078 WP_012775408.1.24086 WP_012775408.1.24150 WP_012775408.1.24175 WP_012775408.1.24187 WP_012775408.1.24208 WP_012775408.1.24431 WP_012775408.1.24858 WP_012775408.1.24883 WP_012775408.1.25245 WP_012775408.1.25280 WP_012775408.1.25381 WP_012775408.1.25396 WP_012775408.1.25617 WP_012775408.1.25711 WP_012775408.1.25798 WP_012775408.1.25824 WP_012775408.1.25841 WP_012775408.1.25950 WP_012775408.1.26009 WP_012775408.1.26302 WP_012775408.1.26324 WP_012775408.1.26368 WP_012775408.1.26507 WP_012775408.1.26620 WP_012775408.1.27108 WP_012775408.1.27225 WP_012775408.1.27227 WP_012775408.1.27381 WP_012775408.1.27476 WP_012775408.1.27695 WP_012775408.1.27754 WP_012775408.1.27760 WP_012775408.1.27767 WP_012775408.1.28000 WP_012775408.1.28033 WP_012775408.1.28099 WP_012775408.1.28244 WP_012775408.1.28467 WP_012775408.1.28645 WP_012775408.1.28796 WP_012775408.1.28805 WP_012775408.1.29141 WP_012775408.1.29299 WP_012775408.1.29542 WP_012775408.1.29545 WP_012775408.1.29610 WP_012775408.1.29635 WP_012775408.1.30079 WP_012775408.1.30136 WP_012775408.1.30241 WP_012775408.1.30344 WP_012775408.1.30414 WP_012775408.1.30562 WP_012775408.1.30785 WP_012775408.1.31254 WP_012775408.1.31418 WP_012775408.1.31425 WP_012775408.1.31597 WP_012775408.1.31707 WP_012775408.1.31730 WP_012775408.1.31763 WP_012775408.1.32048 WP_012775408.1.32213 WP_012775408.1.32259 WP_012775408.1.32292 WP_012775408.1.32332 WP_012775408.1.32380 WP_012775408.1.32466 WP_012775408.1.32630 WP_012775408.1.32947 WP_012775408.1.33330 WP_012775408.1.33471 WP_012775408.1.33494 WP_012775408.1.33623 WP_012775408.1.34222 WP_012775408.1.34321 WP_012775408.1.34425 WP_012775408.1.34527 WP_012775408.1.34652 WP_012775408.1.34738 WP_012775408.1.35430 WP_012775408.1.35551 WP_012775408.1.35675 WP_012775408.1.35725 WP_012775408.1.36136 WP_012775408.1.36153 WP_012775408.1.36180 WP_012775408.1.36251 WP_012775408.1.36341 WP_012775408.1.36365 WP_012775408.1.36437 WP_012775408.1.36611 WP_012775408.1.36766 WP_012775408.1.36945 WP_012775408.1.37126 WP_012775408.1.37237 WP_012775408.1.376 WP_012775408.1.37653 WP_012775408.1.37688 WP_012775408.1.37816 WP_012775408.1.37841 WP_012775408.1.37914 WP_012775408.1.37915 WP_012775408.1.38285 WP_012775408.1.38409 WP_012775408.1.38470 WP_012775408.1.39011 WP_012775408.1.39023 WP_012775408.1.39247 WP_012775408.1.39263 WP_012775408.1.39280 WP_012775408.1.39714 WP_012775408.1.3989 WP_012775408.1.40062 WP_012775408.1.40141 WP_012775408.1.40228 WP_012775408.1.40265 WP_012775408.1.40384 WP_012775408.1.40507 WP_012775408.1.40669 WP_012775408.1.4074 WP_012775408.1.40802 WP_012775408.1.41046 WP_012775408.1.41112 WP_012775408.1.41280 WP_012775408.1.41340 WP_012775408.1.41522 WP_012775408.1.41854 WP_012775408.1.42206 WP_012775408.1.42323 WP_012775408.1.42552 WP_012775408.1.42596 WP_012775408.1.42732 WP_012775408.1.4278 WP_012775408.1.42784 WP_012775408.1.42827 WP_012775408.1.42840 WP_012775408.1.4291 WP_012775408.1.43193 WP_012775408.1.43264 WP_012775408.1.43288 WP_012775408.1.43482 WP_012775408.1.43813 WP_012775408.1.43922 WP_012775408.1.43963 WP_012775408.1.43977 WP_012775408.1.44047 WP_012775408.1.44128 WP_012775408.1.44134 WP_012775408.1.44592 WP_012775408.1.44676 WP_012775408.1.44778 WP_012775408.1.4480 WP_012775408.1.45088 WP_012775408.1.45216 WP_012775408.1.45219 WP_012775408.1.45278 WP_012775408.1.45345 WP_012775408.1.45864 WP_012775408.1.45936 WP_012775408.1.467 WP_012775408.1.46880 WP_012775408.1.47108 WP_012775408.1.47119 WP_012775408.1.47315 WP_012775408.1.47375 WP_012775408.1.47421 WP_012775408.1.47434 WP_012775408.1.4748 WP_012775408.1.4757 WP_012775408.1.47643 WP_012775408.1.47745 WP_012775408.1.47869 WP_012775408.1.47892 WP_012775408.1.47894 WP_012775408.1.47900 WP_012775408.1.48076 WP_012775408.1.48167 WP_012775408.1.48217 WP_012775408.1.48397 WP_012775408.1.4858 WP_012775408.1.48583 WP_012775408.1.48603 WP_012775408.1.48616 WP_012775408.1.49093 WP_012775408.1.49099 WP_012775408.1.49206 WP_012775408.1.49255 WP_012775408.1.49368 WP_012775408.1.49413 WP_012775408.1.49509 WP_012775408.1.49782 WP_012775408.1.49968 WP_012775408.1.50047 WP_012775408.1.50127 WP_012775408.1.5021 WP_012775408.1.50437 WP_012775408.1.50538 WP_012775408.1.50551 WP_012775408.1.50675 WP_012775408.1.50751 WP_012775408.1.5079 WP_012775408.1.50798 WP_012775408.1.51052 WP_012775408.1.51155 WP_012775408.1.51263 WP_012775408.1.51386 WP_012775408.1.51551 WP_012775408.1.52159 WP_012775408.1.52175 WP_012775408.1.52490 WP_012775408.1.52599 WP_012775408.1.52628 WP_012775408.1.52798 WP_012775408.1.53174 WP_012775408.1.53290 WP_012775408.1.53309 WP_012775408.1.53344 WP_012775408.1.534 WP_012775408.1.5344 WP_012775408.1.53448 WP_012775408.1.53487 WP_012775408.1.53749 WP_012775408.1.53805 WP_012775408.1.53918 WP_012775408.1.54000 WP_012775408.1.5404 WP_012775408.1.54184 WP_012775408.1.54384 WP_012775408.1.54488 WP_012775408.1.54535 WP_012775408.1.54683 WP_012775408.1.54800 WP_012775408.1.54828 WP_012775408.1.55064 WP_012775408.1.5509 WP_012775408.1.55137 WP_012775408.1.55158 WP_012775408.1.55649 WP_012775408.1.55687 WP_012775408.1.55714 WP_012775408.1.5579 WP_012775408.1.55815 WP_012775408.1.55833 WP_012775408.1.55834 WP_012775408.1.55975 WP_012775408.1.56077 WP_012775408.1.56140 WP_012775408.1.56150 WP_012775408.1.56215 WP_012775408.1.56434 WP_012775408.1.57006 WP_012775408.1.57067 WP_012775408.1.5714 WP_012775408.1.57164 WP_012775408.1.57189 WP_012775408.1.5754 WP_012775408.1.57640 WP_012775408.1.57674 WP_012775408.1.57810 WP_012775408.1.57938 WP_012775408.1.58077 WP_012775408.1.58229 WP_012775408.1.58517 WP_012775408.1.58566 WP_012775408.1.58585 WP_012775408.1.58706 WP_012775408.1.58746 WP_012775408.1.58793 WP_012775408.1.58815 WP_012775408.1.58903 WP_012775408.1.58933 WP_012775408.1.5894 WP_012775408.1.59071 WP_012775408.1.59138 WP_012775408.1.59144 WP_012775408.1.59283 WP_012775408.1.59349 WP_012775408.1.5936 WP_012775408.1.59524 WP_012775408.1.59647 WP_012775408.1.59702 WP_012775408.1.5974 WP_012775408.1.59929 WP_012775408.1.60237 WP_012775408.1.60293 WP_012775408.1.60377 WP_012775408.1.60445 WP_012775408.1.60658 WP_012775408.1.60659 WP_012775408.1.6071 WP_012775408.1.60853 WP_012775408.1.609 WP_012775408.1.61094 WP_012775408.1.61370 WP_012775408.1.61415 WP_012775408.1.61533 WP_012775408.1.61540 WP_012775408.1.6156 WP_012775408.1.6165 WP_012775408.1.61715 WP_012775408.1.61721 WP_012775408.1.61782 WP_012775408.1.61885 WP_012775408.1.6223 WP_012775408.1.62268 WP_012775408.1.62485 WP_012775408.1.62587 WP_012775408.1.62710 WP_012775408.1.6272 WP_012775408.1.6278 WP_012775408.1.62805 WP_012775408.1.63018 WP_012775408.1.63168 WP_012775408.1.63174 WP_012775408.1.63318 WP_012775408.1.63653 WP_012775408.1.63685 WP_012775408.1.6377 WP_012775408.1.63959 WP_012775408.1.64120 WP_012775408.1.64128 WP_012775408.1.64273 WP_012775408.1.64281 WP_012775408.1.64384 WP_012775408.1.64641 WP_012775408.1.64797 WP_012775408.1.64952 WP_012775408.1.64997 WP_012775408.1.65024 WP_012775408.1.65047 WP_012775408.1.65161 WP_012775408.1.65174 WP_012775408.1.65184 WP_012775408.1.65314 WP_012775408.1.65422 WP_012775408.1.65458 WP_012775408.1.65905 WP_012775408.1.65911 WP_012775408.1.65917 WP_012775408.1.6596 WP_012775408.1.66185 WP_012775408.1.66472 WP_012775408.1.66521 WP_012775408.1.66590 WP_012775408.1.66609 WP_012775408.1.66707 WP_012775408.1.6686 WP_012775408.1.6690 WP_012775408.1.66954 WP_012775408.1.67058 WP_012775408.1.67109 WP_012775408.1.6711 WP_012775408.1.67256 WP_012775408.1.67338 WP_012775408.1.67488 WP_012775408.1.6758 WP_012775408.1.677 WP_012775408.1.67883 WP_012775408.1.67897 WP_012775408.1.67958 WP_012775408.1.67962 WP_012775408.1.68010 WP_012775408.1.68303 WP_012775408.1.68602 WP_012775408.1.68666 WP_012775408.1.68739 WP_012775408.1.68791 WP_012775408.1.68941 WP_012775408.1.69056 WP_012775408.1.69115 WP_012775408.1.69161 WP_012775408.1.69413 WP_012775408.1.69454 WP_012775408.1.6967 WP_012775408.1.69698 WP_012775408.1.69706 WP_012775408.1.69806 WP_012775408.1.69922 WP_012775408.1.70033 WP_012775408.1.70102 WP_012775408.1.70301 WP_012775408.1.70387 WP_012775408.1.70403 WP_012775408.1.70484 WP_012775408.1.70817 WP_012775408.1.70997 WP_012775408.1.71125 WP_012775408.1.71140 WP_012775408.1.71336 WP_012775408.1.71425 WP_012775408.1.71498 WP_012775408.1.71727 WP_012775408.1.71914 WP_012775408.1.72174 WP_012775408.1.72247 WP_012775408.1.72296 WP_012775408.1.72413 WP_012775408.1.7257 WP_012775408.1.72611 WP_012775408.1.73011 WP_012775408.1.73262 WP_012775408.1.73280 WP_012775408.1.73299 WP_012775408.1.7342 WP_012775408.1.73679 WP_012775408.1.73721 WP_012775408.1.73905 WP_012775408.1.74090 WP_012775408.1.74132 WP_012775408.1.74567 WP_012775408.1.74800 WP_012775408.1.74843 WP_012775408.1.74865 WP_012775408.1.75022 WP_012775408.1.75028 WP_012775408.1.75605 WP_012775408.1.75930 WP_012775408.1.75965 WP_012775408.1.75985 WP_012775408.1.76083 WP_012775408.1.76175 WP_012775408.1.76400 WP_012775408.1.76666 WP_012775408.1.76735 WP_012775408.1.76808 WP_012775408.1.76907 WP_012775408.1.77006 WP_012775408.1.77026 WP_012775408.1.7754 WP_012775408.1.77616 WP_012775408.1.77624 WP_012775408.1.7763 WP_012775408.1.77781 WP_012775408.1.77795 WP_012775408.1.77958 WP_012775408.1.78138 WP_012775408.1.78316 WP_012775408.1.78326 WP_012775408.1.78456 WP_012775408.1.7873 WP_012775408.1.78744 WP_012775408.1.78792 WP_012775408.1.7889 WP_012775408.1.78945 WP_012775408.1.79054 WP_012775408.1.79154 WP_012775408.1.79162 WP_012775408.1.79499 WP_012775408.1.79610 WP_012775408.1.79644 WP_012775408.1.79679 WP_012775408.1.80097 WP_012775408.1.80131 WP_012775408.1.80153 WP_012775408.1.80169 WP_012775408.1.80216 WP_012775408.1.80235 WP_012775408.1.80418 WP_012775408.1.8061 WP_012775408.1.80716 WP_012775408.1.80742 WP_012775408.1.8083 WP_012775408.1.81103 WP_012775408.1.81332 WP_012775408.1.81370 WP_012775408.1.81513 WP_012775408.1.81584 WP_012775408.1.81705 WP_012775408.1.82122 WP_012775408.1.82418 WP_012775408.1.8251 WP_012775408.1.82830 WP_012775408.1.82870 WP_012775408.1.82977 WP_012775408.1.83279 WP_012775408.1.83818 WP_012775408.1.83915 WP_012775408.1.8414 WP_012775408.1.84389 WP_012775408.1.84412 WP_012775408.1.84489 WP_012775408.1.8451 WP_012775408.1.84535 WP_012775408.1.85051 WP_012775408.1.85075 WP_012775408.1.85327 WP_012775408.1.85333 WP_012775408.1.85437 WP_012775408.1.85450 WP_012775408.1.85513 WP_012775408.1.85908 WP_012775408.1.86151 WP_012775408.1.86177 WP_012775408.1.86817 WP_012775408.1.86836 WP_012775408.1.86842 WP_012775408.1.87044 WP_012775408.1.87321 WP_012775408.1.87344 WP_012775408.1.87438 WP_012775408.1.87450 WP_012775408.1.87819 WP_012775408.1.87874 WP_012775408.1.87885 WP_012775408.1.8790 WP_012775408.1.88201 WP_012775408.1.88543 WP_012775408.1.88575 WP_012775408.1.88635 WP_012775408.1.88653 WP_012775408.1.88746 WP_012775408.1.88779 WP_012775408.1.88882 WP_012775408.1.88972 WP_012775408.1.89037 WP_012775408.1.89038 WP_012775408.1.89056 WP_012775408.1.89128 WP_012775408.1.89156 WP_012775408.1.89279 WP_012775408.1.89358 WP_012775408.1.89388 WP_012775408.1.89800 WP_012775408.1.8993 WP_012775408.1.89989 WP_012775408.1.90172 WP_012775408.1.90419 WP_012775408.1.90742 WP_012775408.1.90961 WP_012775408.1.91238 WP_012775408.1.91387 WP_012775408.1.91636 WP_012775408.1.91792 WP_012775408.1.91865 WP_012775408.1.91912 WP_012775408.1.91973 WP_012775408.1.91983 WP_012775408.1.92134 WP_012775408.1.92263 WP_012775408.1.92441 WP_012775408.1.92554 WP_012775408.1.92692 WP_012775408.1.92722 WP_012775408.1.928 WP_012775408.1.92964 WP_012775408.1.93190 WP_012775408.1.93220 WP_012775408.1.93456 WP_012775408.1.93519 WP_012775408.1.9361 WP_012775408.1.93627 WP_012775408.1.93646 WP_012775408.1.9376 WP_012775408.1.93771 WP_012775408.1.94332 WP_012775408.1.94338 WP_012775408.1.94418 WP_012775408.1.94419 WP_012775408.1.94449 WP_012775408.1.9454 WP_012775408.1.94639 WP_012775408.1.94780 WP_012775408.1.94786 WP_012775408.1.94945 WP_012775408.1.95180 WP_012775408.1.95213 WP_012775408.1.95214 WP_012775408.1.95262 WP_012775408.1.95288 WP_012775408.1.95351 WP_012775408.1.95542 WP_012775408.1.95788 WP_012775408.1.95798 WP_012775408.1.96164 WP_012775408.1.96282 WP_012775408.1.96451 WP_012775408.1.9652 WP_012775408.1.96524 WP_012775408.1.96574 WP_012775408.1.96700 WP_012775408.1.96973 WP_012775408.1.97052 WP_012775408.1.97453 WP_012775408.1.97493 WP_012775408.1.97504 WP_012775408.1.97515 WP_012775408.1.97554 WP_012775408.1.97857 WP_012775408.1.9809 WP_012775408.1.9815 WP_012775408.1.98253 WP_012775408.1.98271 WP_012775408.1.98326 WP_012775408.1.98343 WP_012775408.1.98406 WP_012775408.1.98416 WP_012775408.1.98860 WP_012775408.1.98864 WP_012775408.1.98889 WP_012775408.1.98921 WP_012775408.1.99127 WP_012775408.1.9922 WP_012775408.1.99252 WP_012775408.1.99324 WP_012775408.1.9956 WP_012775408.1.99696 WP_012775408.1.99988 YP_003029690.1.79686 gi|253754617|ref|YP_003027758.1| gi|386583095|ref|YP_006079499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]