SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478470562|ref|YP_007729203.1| from Chlamydia trachomatis L2b/8200/07

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478470562|ref|YP_007729203.1|
Domain Number 1 Region: 19-224
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-53
Family Phosphate binding protein-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478470562|ref|YP_007729203.1|
Sequence length 241
Comment porphobilinogen deaminase [Chlamydia trachomatis L2b/8200/07]
Sequence
MLSAYYNDPFLADFCLGNIPLRLASRQSSLAVLQAHECLRKLQIFFPRLWGQIITTTTQG
DLDQETPLCAVENTGFFTDDVDFLVQSGQCDLGIHSAKDLPENPKATVVSITASIDPRDI
LVFHEKYLSIPLPRRLRIGSSSVRRKELLSLLYPSAIITDIRGTIQTRLKLLEEKNFDAI
VMANAAVSRLGLRLPCTKILPPPYHPLQGRLAITASRHIRSWRGLFLTCGITEDVEIMCF
S
Download sequence
Identical sequences A0A0E9DY50 A0A0H2X288 G4NME4 O84301
gi|478466953|ref|YP_007718485.1| gi|478463356|ref|YP_007739168.1| gi|478448920|ref|YP_007723843.1| gi|385242587|ref|YP_005810426.1| gi|527325820|ref|YP_008352013.1| gi|385246197|ref|YP_005815019.1| gi|478455228|ref|YP_007727418.1| gi|385243505|ref|YP_005811351.1| gi|478449818|ref|YP_007719375.1| gi|478458848|ref|YP_007732032.1| gi|527327670|ref|YP_008353861.1| gi|478453432|ref|YP_007717594.1| 272561.CT299 315277.CTA_0321 gi|527322802|ref|YP_008348999.1| gi|478454324|ref|YP_007716703.1| gi|15605020|ref|NP_219804.1| gi|478470562|ref|YP_007729203.1| gi|385269977|ref|YP_005813137.1| gi|527323762|ref|YP_008349958.1| gi|478465154|ref|YP_007741836.1| gi|478464254|ref|YP_007740946.1| gi|478457947|ref|YP_007731132.1| gi|478467854|ref|YP_007742727.1| gi|76789021|ref|YP_328107.1| gi|385239811|ref|YP_005807653.1| gi|339625962|ref|YP_004717441.1| gi|478472359|ref|YP_007732926.1| gi|478471453|ref|YP_007740056.1| gi|478452519|ref|YP_007720267.1| gi|478448018|ref|YP_007722052.1| gi|478475068|ref|YP_007724737.1| gi|482545658|ref|YP_007851576.1| gi|478462457|ref|YP_007738278.1| gi|478469663|ref|YP_007722943.1| gi|478447126|ref|YP_007715814.1| NP_219804.1.57406 WP_009871647.1.100466 WP_009871647.1.100644 WP_009871647.1.100883 WP_009871647.1.101362 WP_009871647.1.101735 WP_009871647.1.102133 WP_009871647.1.11148 WP_009871647.1.11717 WP_009871647.1.11732 WP_009871647.1.13674 WP_009871647.1.13766 WP_009871647.1.1409 WP_009871647.1.14786 WP_009871647.1.14984 WP_009871647.1.17082 WP_009871647.1.17422 WP_009871647.1.18643 WP_009871647.1.20093 WP_009871647.1.25195 WP_009871647.1.27753 WP_009871647.1.27980 WP_009871647.1.30792 WP_009871647.1.31128 WP_009871647.1.32856 WP_009871647.1.34934 WP_009871647.1.37956 WP_009871647.1.38181 WP_009871647.1.38504 WP_009871647.1.38794 WP_009871647.1.38813 WP_009871647.1.40272 WP_009871647.1.40464 WP_009871647.1.40808 WP_009871647.1.4187 WP_009871647.1.4264 WP_009871647.1.42718 WP_009871647.1.43504 WP_009871647.1.45552 WP_009871647.1.48923 WP_009871647.1.4939 WP_009871647.1.49465 WP_009871647.1.5036 WP_009871647.1.51159 WP_009871647.1.52091 WP_009871647.1.53299 WP_009871647.1.5416 WP_009871647.1.55117 WP_009871647.1.57520 WP_009871647.1.58308 WP_009871647.1.5967 WP_009871647.1.60427 WP_009871647.1.60937 WP_009871647.1.61004 WP_009871647.1.6151 WP_009871647.1.61683 WP_009871647.1.62239 WP_009871647.1.62489 WP_009871647.1.62968 WP_009871647.1.64162 WP_009871647.1.65182 WP_009871647.1.65391 WP_009871647.1.66489 WP_009871647.1.67250 WP_009871647.1.69355 WP_009871647.1.71307 WP_009871647.1.71619 WP_009871647.1.71686 WP_009871647.1.72034 WP_009871647.1.72164 WP_009871647.1.72442 WP_009871647.1.74323 WP_009871647.1.74635 WP_009871647.1.75470 WP_009871647.1.77153 WP_009871647.1.77651 WP_009871647.1.79775 WP_009871647.1.83525 WP_009871647.1.83642 WP_009871647.1.85365 WP_009871647.1.86066 WP_009871647.1.87079 WP_009871647.1.88937 WP_009871647.1.92427 WP_009871647.1.93216 WP_009871647.1.9343 WP_009871647.1.93600 WP_009871647.1.96955 WP_009871647.1.97423 WP_009871647.1.97602 WP_009871647.1.99598 YP_001654628.2.27483 gi|478457036|ref|YP_007725629.1| gi|385244385|ref|YP_005812229.1| gi|527319994|ref|YP_008346194.1| gi|385269977|ref|YP_005813137.1| gi|478450719|ref|YP_007721161.1| gi|385240733|ref|YP_005808574.1| gi|478459750|ref|YP_007733818.1| gi|478451619|ref|YP_007714925.1| gi|478460653|ref|YP_007735604.1| gi|482546601|ref|YP_007852517.1| gi|527328595|ref|YP_008354785.1| gi|478474164|ref|YP_007730240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]