SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386614048|ref|YP_006133714.1| from Escherichia coli UMNK88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386614048|ref|YP_006133714.1|
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.22e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386614048|ref|YP_006133714.1|
Sequence length 103
Comment cellobiose-specific phosphotransferase, IIA component [Escherichia coli UMNK88]
Sequence
MFADEELVMELLVNAGQARSDAMEAIRCAGQKDWQGATQLMASSESACLQAHKIQTALIS
QDEGCGKIKVNLILVHAQDHLMNAILCQDLAREIISLRKELHA
Download sequence
Identical sequences A0A061KXK1 A0A0E0TYD1 A0A1E2VL56 A0A1X3ILQ3 A0A236TY18 B1LF78 L4JAI6 S0YBW3 S0YXL6 S1F6W5 S1I7S7 T6M3M6 V0AYW4
331112.EcHS_A1618 439855.EcSMS35_1635 WP_001459752.1.100159 WP_001459752.1.100251 WP_001459752.1.100444 WP_001459752.1.100451 WP_001459752.1.100496 WP_001459752.1.100573 WP_001459752.1.100614 WP_001459752.1.100796 WP_001459752.1.10086 WP_001459752.1.10094 WP_001459752.1.101110 WP_001459752.1.101727 WP_001459752.1.10187 WP_001459752.1.10233 WP_001459752.1.112 WP_001459752.1.11418 WP_001459752.1.11436 WP_001459752.1.12468 WP_001459752.1.12594 WP_001459752.1.12679 WP_001459752.1.13608 WP_001459752.1.13664 WP_001459752.1.13974 WP_001459752.1.14277 WP_001459752.1.14914 WP_001459752.1.15177 WP_001459752.1.15420 WP_001459752.1.16500 WP_001459752.1.1655 WP_001459752.1.16612 WP_001459752.1.17119 WP_001459752.1.17123 WP_001459752.1.17150 WP_001459752.1.17216 WP_001459752.1.17282 WP_001459752.1.17757 WP_001459752.1.17831 WP_001459752.1.19075 WP_001459752.1.19206 WP_001459752.1.19361 WP_001459752.1.19644 WP_001459752.1.19684 WP_001459752.1.19691 WP_001459752.1.19795 WP_001459752.1.19878 WP_001459752.1.20331 WP_001459752.1.20515 WP_001459752.1.20691 WP_001459752.1.20958 WP_001459752.1.22280 WP_001459752.1.22359 WP_001459752.1.22579 WP_001459752.1.22649 WP_001459752.1.22783 WP_001459752.1.2300 WP_001459752.1.23330 WP_001459752.1.2362 WP_001459752.1.23676 WP_001459752.1.23724 WP_001459752.1.23985 WP_001459752.1.24088 WP_001459752.1.24089 WP_001459752.1.24124 WP_001459752.1.24499 WP_001459752.1.25042 WP_001459752.1.25126 WP_001459752.1.2597 WP_001459752.1.26588 WP_001459752.1.27057 WP_001459752.1.2712 WP_001459752.1.27188 WP_001459752.1.27214 WP_001459752.1.27774 WP_001459752.1.27797 WP_001459752.1.29016 WP_001459752.1.29164 WP_001459752.1.2942 WP_001459752.1.29603 WP_001459752.1.29967 WP_001459752.1.30004 WP_001459752.1.3045 WP_001459752.1.30554 WP_001459752.1.30733 WP_001459752.1.30866 WP_001459752.1.31421 WP_001459752.1.31898 WP_001459752.1.3201 WP_001459752.1.3212 WP_001459752.1.32722 WP_001459752.1.32815 WP_001459752.1.33238 WP_001459752.1.334 WP_001459752.1.33974 WP_001459752.1.34204 WP_001459752.1.34270 WP_001459752.1.347 WP_001459752.1.34982 WP_001459752.1.35195 WP_001459752.1.35740 WP_001459752.1.36531 WP_001459752.1.36699 WP_001459752.1.36904 WP_001459752.1.37057 WP_001459752.1.38185 WP_001459752.1.38533 WP_001459752.1.38843 WP_001459752.1.39367 WP_001459752.1.39541 WP_001459752.1.39594 WP_001459752.1.39610 WP_001459752.1.39970 WP_001459752.1.40842 WP_001459752.1.41363 WP_001459752.1.41484 WP_001459752.1.41813 WP_001459752.1.42432 WP_001459752.1.4290 WP_001459752.1.42989 WP_001459752.1.43174 WP_001459752.1.43444 WP_001459752.1.43622 WP_001459752.1.44211 WP_001459752.1.44324 WP_001459752.1.44759 WP_001459752.1.44784 WP_001459752.1.44821 WP_001459752.1.44960 WP_001459752.1.45025 WP_001459752.1.45043 WP_001459752.1.45116 WP_001459752.1.45313 WP_001459752.1.45752 WP_001459752.1.46329 WP_001459752.1.46643 WP_001459752.1.46932 WP_001459752.1.46994 WP_001459752.1.47156 WP_001459752.1.47280 WP_001459752.1.47322 WP_001459752.1.48203 WP_001459752.1.48477 WP_001459752.1.49236 WP_001459752.1.49459 WP_001459752.1.50266 WP_001459752.1.5056 WP_001459752.1.50564 WP_001459752.1.5067 WP_001459752.1.50717 WP_001459752.1.50947 WP_001459752.1.5106 WP_001459752.1.51255 WP_001459752.1.51425 WP_001459752.1.51462 WP_001459752.1.51587 WP_001459752.1.51690 WP_001459752.1.52062 WP_001459752.1.52135 WP_001459752.1.5265 WP_001459752.1.5272 WP_001459752.1.53327 WP_001459752.1.53482 WP_001459752.1.53594 WP_001459752.1.54329 WP_001459752.1.54625 WP_001459752.1.54927 WP_001459752.1.54993 WP_001459752.1.55005 WP_001459752.1.55425 WP_001459752.1.55556 WP_001459752.1.55563 WP_001459752.1.55720 WP_001459752.1.56436 WP_001459752.1.56786 WP_001459752.1.56980 WP_001459752.1.57492 WP_001459752.1.58384 WP_001459752.1.58475 WP_001459752.1.58692 WP_001459752.1.58837 WP_001459752.1.59047 WP_001459752.1.59533 WP_001459752.1.59615 WP_001459752.1.60151 WP_001459752.1.60732 WP_001459752.1.61005 WP_001459752.1.61046 WP_001459752.1.61181 WP_001459752.1.62481 WP_001459752.1.62642 WP_001459752.1.62668 WP_001459752.1.6323 WP_001459752.1.63246 WP_001459752.1.63478 WP_001459752.1.63721 WP_001459752.1.64138 WP_001459752.1.6416 WP_001459752.1.6431 WP_001459752.1.64353 WP_001459752.1.64749 WP_001459752.1.6499 WP_001459752.1.64990 WP_001459752.1.65040 WP_001459752.1.65179 WP_001459752.1.66624 WP_001459752.1.67293 WP_001459752.1.67660 WP_001459752.1.67732 WP_001459752.1.68396 WP_001459752.1.6877 WP_001459752.1.68865 WP_001459752.1.6923 WP_001459752.1.69341 WP_001459752.1.69569 WP_001459752.1.69872 WP_001459752.1.6993 WP_001459752.1.7102 WP_001459752.1.71272 WP_001459752.1.71285 WP_001459752.1.71315 WP_001459752.1.71403 WP_001459752.1.71912 WP_001459752.1.72033 WP_001459752.1.72279 WP_001459752.1.72544 WP_001459752.1.72745 WP_001459752.1.72947 WP_001459752.1.73292 WP_001459752.1.7376 WP_001459752.1.73843 WP_001459752.1.74123 WP_001459752.1.74549 WP_001459752.1.75145 WP_001459752.1.75149 WP_001459752.1.75687 WP_001459752.1.75735 WP_001459752.1.75983 WP_001459752.1.76039 WP_001459752.1.76184 WP_001459752.1.76211 WP_001459752.1.76361 WP_001459752.1.76909 WP_001459752.1.77175 WP_001459752.1.77253 WP_001459752.1.77657 WP_001459752.1.78481 WP_001459752.1.7985 WP_001459752.1.80060 WP_001459752.1.80524 WP_001459752.1.80626 WP_001459752.1.80662 WP_001459752.1.81127 WP_001459752.1.81286 WP_001459752.1.81618 WP_001459752.1.81935 WP_001459752.1.82901 WP_001459752.1.83144 WP_001459752.1.83205 WP_001459752.1.83238 WP_001459752.1.83415 WP_001459752.1.83781 WP_001459752.1.84298 WP_001459752.1.84467 WP_001459752.1.84875 WP_001459752.1.84972 WP_001459752.1.85773 WP_001459752.1.86189 WP_001459752.1.86227 WP_001459752.1.86228 WP_001459752.1.86234 WP_001459752.1.86753 WP_001459752.1.86760 WP_001459752.1.87465 WP_001459752.1.88961 WP_001459752.1.89069 WP_001459752.1.89899 WP_001459752.1.89927 WP_001459752.1.90389 WP_001459752.1.90865 WP_001459752.1.91640 WP_001459752.1.91782 WP_001459752.1.91787 WP_001459752.1.91850 WP_001459752.1.91879 WP_001459752.1.9199 WP_001459752.1.92114 WP_001459752.1.92305 WP_001459752.1.92638 WP_001459752.1.9264 WP_001459752.1.92708 WP_001459752.1.93309 WP_001459752.1.93629 WP_001459752.1.94754 WP_001459752.1.95932 WP_001459752.1.96015 WP_001459752.1.96281 WP_001459752.1.96609 WP_001459752.1.97119 WP_001459752.1.97439 WP_001459752.1.97560 WP_001459752.1.97825 WP_001459752.1.97996 WP_001459752.1.98012 WP_001459752.1.98220 WP_001459752.1.98578 WP_001459752.1.99265 WP_001459752.1.99310 WP_001459752.1.99400 WP_001459752.1.99632 WP_001459752.1.99929 gi|386614048|ref|YP_006133714.1| gi|170683356|ref|YP_001743689.1| gi|157161004|ref|YP_001458322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]