SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386614287|ref|YP_006133953.1| from Escherichia coli UMNK88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386614287|ref|YP_006133953.1|
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 7.19e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386614287|ref|YP_006133953.1|
Sequence length 116
Comment cellobiose-specific phosphotransferase enzyme IIA component protein LacF [Escherichia coli UMNK88]
Sequence
MMDLDNIPDTQTEAEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMA
LNEAHLVQTKLIEGDAGEGKMKVSLMLVHAQDHLMTSMLARELITELIELHEKLKA
Download sequence
Identical sequences A0A0E0TYY6
gi|386614287|ref|YP_006133953.1| WP_000968918.1.19684 WP_000968918.1.29016 WP_000968918.1.39594 WP_000968918.1.41484 WP_000968918.1.47156 WP_000968918.1.51587 WP_000968918.1.58837 WP_000968918.1.59047 WP_000968918.1.67293 WP_000968918.1.67732 WP_000968918.1.73843 WP_000968918.1.75687 WP_000968918.1.80060 WP_000968918.1.81618 WP_000968918.1.98578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]