SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386614431|ref|YP_006134097.1| from Escherichia coli UMNK88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386614431|ref|YP_006134097.1|
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily CutC-like 9.81e-78
Family CutC-like 0.000000000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386614431|ref|YP_006134097.1|
Sequence length 248
Comment hypothetical protein UMNK88_2346 [Escherichia coli UMNK88]
Sequence
MALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRP
RGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTF
HRAFDMCANPLNTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVR
AENLHHFLDAGVLEVHSSAGAWQASPMRYRNQGLSMSSDAHADEYSRYVVDGAAVAEMKG
IIERHQAK
Download sequence
Identical sequences A0A024KWV3 A0A077ZJK2 A0A0A0FDU5 A0A0E0U0N3 A0A0E1T0T2 A0A140NB90 A0A142H3W8 A0A1E3MYH8 A0A1S9JLX4 A8A176 B1J0L4 D6IBI5 E3PAH7 L2UZQ4 S1DT29 S1F4X2 S1HH83 S1I8S4 T9CTG9 V2S7I6 W1BGS6 W8T959
331112.EcHS_A1969 469008.ECBD_1764 481805.EcolC_1758 gi|253773169|ref|YP_003036000.1| gi|387612361|ref|YP_006115477.1| gi|170019781|ref|YP_001724735.1| gi|157161345|ref|YP_001458663.1| gi|386614431|ref|YP_006134097.1| WP_001185727.1.100251 WP_001185727.1.100451 WP_001185727.1.100487 WP_001185727.1.100614 WP_001185727.1.10086 WP_001185727.1.10094 WP_001185727.1.100966 WP_001185727.1.101282 WP_001185727.1.101737 WP_001185727.1.101777 WP_001185727.1.10187 WP_001185727.1.101908 WP_001185727.1.10233 WP_001185727.1.10569 WP_001185727.1.11241 WP_001185727.1.11418 WP_001185727.1.11436 WP_001185727.1.11437 WP_001185727.1.1168 WP_001185727.1.11803 WP_001185727.1.1196 WP_001185727.1.11981 WP_001185727.1.12060 WP_001185727.1.12458 WP_001185727.1.12468 WP_001185727.1.12566 WP_001185727.1.12594 WP_001185727.1.12675 WP_001185727.1.12680 WP_001185727.1.127 WP_001185727.1.12775 WP_001185727.1.13002 WP_001185727.1.13252 WP_001185727.1.13608 WP_001185727.1.13644 WP_001185727.1.13656 WP_001185727.1.13664 WP_001185727.1.13672 WP_001185727.1.13824 WP_001185727.1.13974 WP_001185727.1.14277 WP_001185727.1.14292 WP_001185727.1.1438 WP_001185727.1.14508 WP_001185727.1.14661 WP_001185727.1.1470 WP_001185727.1.15117 WP_001185727.1.153 WP_001185727.1.15538 WP_001185727.1.15740 WP_001185727.1.16102 WP_001185727.1.1634 WP_001185727.1.16500 WP_001185727.1.1655 WP_001185727.1.16612 WP_001185727.1.17119 WP_001185727.1.17123 WP_001185727.1.17150 WP_001185727.1.17153 WP_001185727.1.17216 WP_001185727.1.17282 WP_001185727.1.17290 WP_001185727.1.17360 WP_001185727.1.17432 WP_001185727.1.17534 WP_001185727.1.17701 WP_001185727.1.17831 WP_001185727.1.17889 WP_001185727.1.17937 WP_001185727.1.17961 WP_001185727.1.18050 WP_001185727.1.18064 WP_001185727.1.18133 WP_001185727.1.18229 WP_001185727.1.18316 WP_001185727.1.18329 WP_001185727.1.18550 WP_001185727.1.18588 WP_001185727.1.18650 WP_001185727.1.18699 WP_001185727.1.18734 WP_001185727.1.18858 WP_001185727.1.19075 WP_001185727.1.1909 WP_001185727.1.19206 WP_001185727.1.19361 WP_001185727.1.19441 WP_001185727.1.19655 WP_001185727.1.19684 WP_001185727.1.19691 WP_001185727.1.19795 WP_001185727.1.19878 WP_001185727.1.19994 WP_001185727.1.20133 WP_001185727.1.20151 WP_001185727.1.20170 WP_001185727.1.20331 WP_001185727.1.20388 WP_001185727.1.20445 WP_001185727.1.20506 WP_001185727.1.20515 WP_001185727.1.20549 WP_001185727.1.20691 WP_001185727.1.20765 WP_001185727.1.20863 WP_001185727.1.20943 WP_001185727.1.20958 WP_001185727.1.21017 WP_001185727.1.21251 WP_001185727.1.2142 WP_001185727.1.21661 WP_001185727.1.21945 WP_001185727.1.22021 WP_001185727.1.22314 WP_001185727.1.22359 WP_001185727.1.22363 WP_001185727.1.22574 WP_001185727.1.22649 WP_001185727.1.22765 WP_001185727.1.2300 WP_001185727.1.23351 WP_001185727.1.23463 WP_001185727.1.23549 WP_001185727.1.2362 WP_001185727.1.23676 WP_001185727.1.23804 WP_001185727.1.24089 WP_001185727.1.24124 WP_001185727.1.24136 WP_001185727.1.2418 WP_001185727.1.24316 WP_001185727.1.24523 WP_001185727.1.24808 WP_001185727.1.24876 WP_001185727.1.25042 WP_001185727.1.25126 WP_001185727.1.2531 WP_001185727.1.25312 WP_001185727.1.25525 WP_001185727.1.25643 WP_001185727.1.26048 WP_001185727.1.26264 WP_001185727.1.26379 WP_001185727.1.26517 WP_001185727.1.26588 WP_001185727.1.26720 WP_001185727.1.27098 WP_001185727.1.27214 WP_001185727.1.27313 WP_001185727.1.27611 WP_001185727.1.27774 WP_001185727.1.28268 WP_001185727.1.28371 WP_001185727.1.28760 WP_001185727.1.28950 WP_001185727.1.28994 WP_001185727.1.29016 WP_001185727.1.29239 WP_001185727.1.2926 WP_001185727.1.2942 WP_001185727.1.29429 WP_001185727.1.2945 WP_001185727.1.29689 WP_001185727.1.2995 WP_001185727.1.29967 WP_001185727.1.30004 WP_001185727.1.30247 WP_001185727.1.30253 WP_001185727.1.3045 WP_001185727.1.30472 WP_001185727.1.30479 WP_001185727.1.30497 WP_001185727.1.30546 WP_001185727.1.30554 WP_001185727.1.30783 WP_001185727.1.31000 WP_001185727.1.31421 WP_001185727.1.31506 WP_001185727.1.3193 WP_001185727.1.3212 WP_001185727.1.32138 WP_001185727.1.32394 WP_001185727.1.32722 WP_001185727.1.33004 WP_001185727.1.33238 WP_001185727.1.33385 WP_001185727.1.334 WP_001185727.1.33526 WP_001185727.1.33545 WP_001185727.1.33736 WP_001185727.1.33751 WP_001185727.1.33799 WP_001185727.1.33854 WP_001185727.1.33879 WP_001185727.1.33974 WP_001185727.1.342 WP_001185727.1.34270 WP_001185727.1.34332 WP_001185727.1.34456 WP_001185727.1.347 WP_001185727.1.34982 WP_001185727.1.35114 WP_001185727.1.35195 WP_001185727.1.35466 WP_001185727.1.35704 WP_001185727.1.35740 WP_001185727.1.35789 WP_001185727.1.35904 WP_001185727.1.36386 WP_001185727.1.36531 WP_001185727.1.36739 WP_001185727.1.36747 WP_001185727.1.36817 WP_001185727.1.36833 WP_001185727.1.36925 WP_001185727.1.37057 WP_001185727.1.37352 WP_001185727.1.37745 WP_001185727.1.37817 WP_001185727.1.3788 WP_001185727.1.38080 WP_001185727.1.38120 WP_001185727.1.3815 WP_001185727.1.38155 WP_001185727.1.38182 WP_001185727.1.38211 WP_001185727.1.3822 WP_001185727.1.38363 WP_001185727.1.38533 WP_001185727.1.39150 WP_001185727.1.39167 WP_001185727.1.39367 WP_001185727.1.39541 WP_001185727.1.3980 WP_001185727.1.39966 WP_001185727.1.39992 WP_001185727.1.40013 WP_001185727.1.40218 WP_001185727.1.40298 WP_001185727.1.40666 WP_001185727.1.40712 WP_001185727.1.40833 WP_001185727.1.40898 WP_001185727.1.41239 WP_001185727.1.41346 WP_001185727.1.41363 WP_001185727.1.41484 WP_001185727.1.41741 WP_001185727.1.41813 WP_001185727.1.41826 WP_001185727.1.41885 WP_001185727.1.41960 WP_001185727.1.42113 WP_001185727.1.42159 WP_001185727.1.42214 WP_001185727.1.42318 WP_001185727.1.42432 WP_001185727.1.42516 WP_001185727.1.42547 WP_001185727.1.42632 WP_001185727.1.42771 WP_001185727.1.42879 WP_001185727.1.4290 WP_001185727.1.42989 WP_001185727.1.43174 WP_001185727.1.43216 WP_001185727.1.43444 WP_001185727.1.43598 WP_001185727.1.43622 WP_001185727.1.43769 WP_001185727.1.43989 WP_001185727.1.44075 WP_001185727.1.44211 WP_001185727.1.44324 WP_001185727.1.44354 WP_001185727.1.4473 WP_001185727.1.44821 WP_001185727.1.44841 WP_001185727.1.44980 WP_001185727.1.45025 WP_001185727.1.45043 WP_001185727.1.45116 WP_001185727.1.45313 WP_001185727.1.45329 WP_001185727.1.45440 WP_001185727.1.4574 WP_001185727.1.45752 WP_001185727.1.45968 WP_001185727.1.46026 WP_001185727.1.46329 WP_001185727.1.46573 WP_001185727.1.4670 WP_001185727.1.46820 WP_001185727.1.47063 WP_001185727.1.47156 WP_001185727.1.47186 WP_001185727.1.4722 WP_001185727.1.47224 WP_001185727.1.47322 WP_001185727.1.47425 WP_001185727.1.47464 WP_001185727.1.47654 WP_001185727.1.47673 WP_001185727.1.47740 WP_001185727.1.47764 WP_001185727.1.4796 WP_001185727.1.48080 WP_001185727.1.48203 WP_001185727.1.48353 WP_001185727.1.48421 WP_001185727.1.48477 WP_001185727.1.4871 WP_001185727.1.48847 WP_001185727.1.48860 WP_001185727.1.48926 WP_001185727.1.48970 WP_001185727.1.49076 WP_001185727.1.49236 WP_001185727.1.49661 WP_001185727.1.497 WP_001185727.1.50179 WP_001185727.1.50214 WP_001185727.1.50266 WP_001185727.1.50427 WP_001185727.1.5056 WP_001185727.1.50564 WP_001185727.1.5067 WP_001185727.1.50717 WP_001185727.1.5106 WP_001185727.1.51255 WP_001185727.1.51300 WP_001185727.1.51325 WP_001185727.1.51330 WP_001185727.1.51380 WP_001185727.1.51425 WP_001185727.1.51548 WP_001185727.1.51629 WP_001185727.1.51968 WP_001185727.1.52062 WP_001185727.1.52270 WP_001185727.1.52333 WP_001185727.1.52399 WP_001185727.1.52421 WP_001185727.1.52524 WP_001185727.1.52544 WP_001185727.1.5265 WP_001185727.1.5272 WP_001185727.1.52852 WP_001185727.1.53244 WP_001185727.1.53327 WP_001185727.1.53482 WP_001185727.1.53594 WP_001185727.1.54002 WP_001185727.1.54328 WP_001185727.1.54329 WP_001185727.1.54344 WP_001185727.1.54429 WP_001185727.1.54463 WP_001185727.1.54476 WP_001185727.1.54507 WP_001185727.1.5461 WP_001185727.1.54620 WP_001185727.1.54625 WP_001185727.1.54769 WP_001185727.1.54981 WP_001185727.1.55005 WP_001185727.1.55112 WP_001185727.1.55151 WP_001185727.1.55226 WP_001185727.1.55424 WP_001185727.1.55425 WP_001185727.1.55507 WP_001185727.1.55556 WP_001185727.1.55676 WP_001185727.1.55720 WP_001185727.1.56197 WP_001185727.1.56285 WP_001185727.1.56436 WP_001185727.1.56786 WP_001185727.1.56789 WP_001185727.1.56980 WP_001185727.1.57386 WP_001185727.1.57401 WP_001185727.1.57719 WP_001185727.1.5786 WP_001185727.1.57904 WP_001185727.1.58060 WP_001185727.1.5810 WP_001185727.1.58384 WP_001185727.1.58837 WP_001185727.1.58867 WP_001185727.1.59024 WP_001185727.1.59047 WP_001185727.1.59513 WP_001185727.1.59533 WP_001185727.1.59590 WP_001185727.1.60067 WP_001185727.1.60151 WP_001185727.1.60436 WP_001185727.1.60550 WP_001185727.1.60567 WP_001185727.1.60576 WP_001185727.1.60764 WP_001185727.1.61005 WP_001185727.1.6106 WP_001185727.1.61102 WP_001185727.1.61170 WP_001185727.1.61181 WP_001185727.1.61183 WP_001185727.1.61505 WP_001185727.1.61770 WP_001185727.1.61822 WP_001185727.1.62099 WP_001185727.1.62157 WP_001185727.1.62296 WP_001185727.1.62668 WP_001185727.1.63246 WP_001185727.1.6337 WP_001185727.1.63478 WP_001185727.1.63721 WP_001185727.1.64045 WP_001185727.1.64110 WP_001185727.1.6416 WP_001185727.1.64165 WP_001185727.1.6431 WP_001185727.1.64321 WP_001185727.1.647 WP_001185727.1.64749 WP_001185727.1.64784 WP_001185727.1.64912 WP_001185727.1.64926 WP_001185727.1.6499 WP_001185727.1.65040 WP_001185727.1.65061 WP_001185727.1.65151 WP_001185727.1.65596 WP_001185727.1.6563 WP_001185727.1.66022 WP_001185727.1.66050 WP_001185727.1.66105 WP_001185727.1.66280 WP_001185727.1.66624 WP_001185727.1.67022 WP_001185727.1.67200 WP_001185727.1.67210 WP_001185727.1.67293 WP_001185727.1.67660 WP_001185727.1.67681 WP_001185727.1.67685 WP_001185727.1.67732 WP_001185727.1.67787 WP_001185727.1.67861 WP_001185727.1.6877 WP_001185727.1.68865 WP_001185727.1.68915 WP_001185727.1.69033 WP_001185727.1.69127 WP_001185727.1.6923 WP_001185727.1.69258 WP_001185727.1.6945 WP_001185727.1.69583 WP_001185727.1.69646 WP_001185727.1.70619 WP_001185727.1.70767 WP_001185727.1.71183 WP_001185727.1.71199 WP_001185727.1.71229 WP_001185727.1.71272 WP_001185727.1.71285 WP_001185727.1.71312 WP_001185727.1.71315 WP_001185727.1.71403 WP_001185727.1.71480 WP_001185727.1.71632 WP_001185727.1.72033 WP_001185727.1.72053 WP_001185727.1.72090 WP_001185727.1.72162 WP_001185727.1.72184 WP_001185727.1.72186 WP_001185727.1.72237 WP_001185727.1.7225 WP_001185727.1.72279 WP_001185727.1.72316 WP_001185727.1.72511 WP_001185727.1.72522 WP_001185727.1.72544 WP_001185727.1.72745 WP_001185727.1.72860 WP_001185727.1.72947 WP_001185727.1.73039 WP_001185727.1.7307 WP_001185727.1.73094 WP_001185727.1.73129 WP_001185727.1.73243 WP_001185727.1.73259 WP_001185727.1.73292 WP_001185727.1.73524 WP_001185727.1.7376 WP_001185727.1.73843 WP_001185727.1.73844 WP_001185727.1.7411 WP_001185727.1.74123 WP_001185727.1.74445 WP_001185727.1.74520 WP_001185727.1.75139 WP_001185727.1.75145 WP_001185727.1.75149 WP_001185727.1.7516 WP_001185727.1.75428 WP_001185727.1.75491 WP_001185727.1.75515 WP_001185727.1.75672 WP_001185727.1.75687 WP_001185727.1.75735 WP_001185727.1.7617 WP_001185727.1.76184 WP_001185727.1.76361 WP_001185727.1.76390 WP_001185727.1.76462 WP_001185727.1.76547 WP_001185727.1.76562 WP_001185727.1.76909 WP_001185727.1.76933 WP_001185727.1.76948 WP_001185727.1.77042 WP_001185727.1.77175 WP_001185727.1.77291 WP_001185727.1.77470 WP_001185727.1.77471 WP_001185727.1.77768 WP_001185727.1.78000 WP_001185727.1.78007 WP_001185727.1.7804 WP_001185727.1.7808 WP_001185727.1.78235 WP_001185727.1.78413 WP_001185727.1.78481 WP_001185727.1.78612 WP_001185727.1.78791 WP_001185727.1.79306 WP_001185727.1.79356 WP_001185727.1.79369 WP_001185727.1.79414 WP_001185727.1.79505 WP_001185727.1.79591 WP_001185727.1.79764 WP_001185727.1.79871 WP_001185727.1.79877 WP_001185727.1.79931 WP_001185727.1.80050 WP_001185727.1.80060 WP_001185727.1.8011 WP_001185727.1.80179 WP_001185727.1.80183 WP_001185727.1.80519 WP_001185727.1.80524 WP_001185727.1.80577 WP_001185727.1.80626 WP_001185727.1.80662 WP_001185727.1.80666 WP_001185727.1.80756 WP_001185727.1.80768 WP_001185727.1.81127 WP_001185727.1.81286 WP_001185727.1.81576 WP_001185727.1.81618 WP_001185727.1.81723 WP_001185727.1.81806 WP_001185727.1.81935 WP_001185727.1.8235 WP_001185727.1.82536 WP_001185727.1.82661 WP_001185727.1.82691 WP_001185727.1.82718 WP_001185727.1.82799 WP_001185727.1.82853 WP_001185727.1.83097 WP_001185727.1.83140 WP_001185727.1.83144 WP_001185727.1.83205 WP_001185727.1.83415 WP_001185727.1.8345 WP_001185727.1.83537 WP_001185727.1.83544 WP_001185727.1.83781 WP_001185727.1.83941 WP_001185727.1.84004 WP_001185727.1.84298 WP_001185727.1.84313 WP_001185727.1.84738 WP_001185727.1.84740 WP_001185727.1.84875 WP_001185727.1.84877 WP_001185727.1.84972 WP_001185727.1.84977 WP_001185727.1.85090 WP_001185727.1.85255 WP_001185727.1.85323 WP_001185727.1.85500 WP_001185727.1.85657 WP_001185727.1.85806 WP_001185727.1.8592 WP_001185727.1.86001 WP_001185727.1.86016 WP_001185727.1.86161 WP_001185727.1.86189 WP_001185727.1.8621 WP_001185727.1.86276 WP_001185727.1.86691 WP_001185727.1.86760 WP_001185727.1.86787 WP_001185727.1.86959 WP_001185727.1.87199 WP_001185727.1.87574 WP_001185727.1.88149 WP_001185727.1.88263 WP_001185727.1.8848 WP_001185727.1.88598 WP_001185727.1.88607 WP_001185727.1.88667 WP_001185727.1.88729 WP_001185727.1.88757 WP_001185727.1.88880 WP_001185727.1.88950 WP_001185727.1.88961 WP_001185727.1.89416 WP_001185727.1.89492 WP_001185727.1.89700 WP_001185727.1.89710 WP_001185727.1.89923 WP_001185727.1.89927 WP_001185727.1.89977 WP_001185727.1.90389 WP_001185727.1.90449 WP_001185727.1.90511 WP_001185727.1.90520 WP_001185727.1.90799 WP_001185727.1.90839 WP_001185727.1.90865 WP_001185727.1.90924 WP_001185727.1.9104 WP_001185727.1.91462 WP_001185727.1.91511 WP_001185727.1.91640 WP_001185727.1.91850 WP_001185727.1.91994 WP_001185727.1.92019 WP_001185727.1.9215 WP_001185727.1.92532 WP_001185727.1.9264 WP_001185727.1.92750 WP_001185727.1.92781 WP_001185727.1.93309 WP_001185727.1.93629 WP_001185727.1.93652 WP_001185727.1.93971 WP_001185727.1.94025 WP_001185727.1.94176 WP_001185727.1.94353 WP_001185727.1.94445 WP_001185727.1.94542 WP_001185727.1.94646 WP_001185727.1.94692 WP_001185727.1.94695 WP_001185727.1.94764 WP_001185727.1.94898 WP_001185727.1.95395 WP_001185727.1.95919 WP_001185727.1.95932 WP_001185727.1.96086 WP_001185727.1.96279 WP_001185727.1.96339 WP_001185727.1.96394 WP_001185727.1.97119 WP_001185727.1.97170 WP_001185727.1.9723 WP_001185727.1.97439 WP_001185727.1.97459 WP_001185727.1.97560 WP_001185727.1.97677 WP_001185727.1.97825 WP_001185727.1.97932 WP_001185727.1.97982 WP_001185727.1.97996 WP_001185727.1.98005 WP_001185727.1.98220 WP_001185727.1.98244 WP_001185727.1.98294 WP_001185727.1.98442 WP_001185727.1.98578 WP_001185727.1.98614 WP_001185727.1.9864 WP_001185727.1.99265 WP_001185727.1.99310 WP_001185727.1.9935 WP_001185727.1.99929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]