SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386708057|ref|YP_006171778.1| from Escherichia coli W

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386708057|ref|YP_006171778.1|
Domain Number - Region: 127-159
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0706
Family NfeD domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386708057|ref|YP_006171778.1|
Sequence length 221
Comment flagellar basal body L-ring protein [Escherichia coli W]
Sequence
MKNYLWLVALLPLLSGCESQAILVKKDDAYFAPPKTEAPPPADGRAGGVFETGYNWSLTA
DRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTVDIGAPTIFGHTKDKLSGSIDANRDF
DGSATSQQQNSLRGEITVSVHAVQPNGILEIRGEKWLTLNQGDEYIRLSGLVRADDIQND
NSVSSQRIADARISYAVRGALSDANAAGWLTRLFNHPLFPI
Download sequence
Identical sequences A0A2I8AYU7
gi|386708057|ref|YP_006171778.1| gi|544392824|ref|YP_008563475.1| gi|386708057|ref|YP_006171778.1| WP_000800869.1.12342 WP_000800869.1.13495 WP_000800869.1.15282 WP_000800869.1.23135 WP_000800869.1.43750 WP_000800869.1.63746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]