SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|527330643|ref|YP_008356832.1| from Streptococcus lutetiensis 033

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|527330643|ref|YP_008356832.1|
Domain Number 1 Region: 6-226
Classification Level Classification E-value
Superfamily Ribosomal protein L1 1.01e-81
Family Ribosomal protein L1 0.000000585
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|527330643|ref|YP_008356832.1|
Sequence length 229
Comment 50S ribosomal protein L1 RplA [Streptococcus lutetiensis 033]
Sequence
MAKKSKQMRAALEKIDSTKAYSVEEAVALAKETNFAKFDASVEVAYKLNIDVRKADQQIR
GAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKINDGWLDFDVVIATPDM
MAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQAIIGKVSF
DADKLVENFKAIHEVMVKSKPATAKGTYMTNLSITTTQGVGIKVDPSSF
Download sequence
Identical sequences A0A060RK43 A0A091BQZ9 A0A0U3F8W1 A0A0W7V787 A0A1H6QMB0 E8JPR6 H6PBW3 S5R197 T0UF48
WP_004232886.1.100970 WP_004232886.1.21092 WP_004232886.1.2256 WP_004232886.1.23792 WP_004232886.1.24013 WP_004232886.1.24313 WP_004232886.1.26722 WP_004232886.1.2751 WP_004232886.1.27943 WP_004232886.1.32017 WP_004232886.1.33417 WP_004232886.1.37197 WP_004232886.1.37413 WP_004232886.1.40857 WP_004232886.1.44829 WP_004232886.1.44883 WP_004232886.1.4534 WP_004232886.1.4692 WP_004232886.1.47301 WP_004232886.1.55313 WP_004232886.1.58830 WP_004232886.1.60743 WP_004232886.1.61657 WP_004232886.1.6465 WP_004232886.1.6693 WP_004232886.1.70779 WP_004232886.1.7609 WP_004232886.1.80007 WP_004232886.1.80398 WP_004232886.1.81430 WP_004232886.1.88031 WP_004232886.1.88070 WP_004232886.1.90880 WP_004232886.1.95838 WP_004232886.1.97712 WP_004232886.1.97926 gi|527330643|ref|YP_008356832.1| gi|379705772|ref|YP_005204231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]