SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387881710|ref|YP_006312012.1| from Escherichia coli Xuzhou21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387881710|ref|YP_006312012.1|
Domain Number 1 Region: 117-309
Classification Level Classification E-value
Superfamily DNA primase core 7.76e-59
Family Primase fragment of primase-helicase protein 0.00066
Further Details:      
 
Domain Number 2 Region: 375-462,684-714
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.32e-19
Family Intein (protein splicing domain) 0.028
Further Details:      
 
Domain Number 3 Region: 563-639
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000408
Family Intein endonuclease 0.011
Further Details:      
 
Domain Number 4 Region: 717-887
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000399
Family RecA protein-like (ATPase-domain) 0.012
Further Details:      
 
Domain Number 5 Region: 16-92
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000000238
Family DNA primase zinc finger 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387881710|ref|YP_006312012.1|
Sequence length 968
Comment putative replication protein P [Escherichia coli Xuzhou21]
Sequence
MTPSELSDLLWAQVDRVAPHLLPNGKKEGHEWVAGNVNGDKGNSLKVNISGKKKWADFAE
GDGGDMLDLWMACRGINLHQAMQEAKAFLGIKDDDHHFDAKREKKFSRPDRKKIARYVTR
TESHLEYLQSRGISPEIVKRYEVVSGKVWNGERELDALVLPYKRDGELLQVKRISTERPD
GKKVIMAEGDCEPCLFGWQALDAGVRAVVLCEGEIDCMSYAQYGISALSVPFGGGKGAKQ
QWIEFEYHNLDRFEEIFISMDVDDVGREAAREIASRLGEHRCRLVTLPYKDINECLMNGV
TEDEIWQYIGTASYFDPEELYSAREFYQDTINAFYGKKQYLFNPPWESLADKFQFREAEL
TLVNGVNGHGKACPLNEPILLADGTWTTHGDVKIGDQVASVDGNPSTVTGIFPQGVRDVY
RVTFEDGRYVDCAGDHLWEVTSRGFTKGEKRRVIDTFELKRLSETKRHKNGVRIPEITGD
FGDHSEPLAWVIGSLLGDGSLSNGSVKFSNVEPYMIERMKAELPDYNFSGDGKDWLISTA
RGQANPLMETLRGYGLMGCTAKNKFIPRVFFSANKSTRIGMLCGLLETDGYVEKDGTLVF
SSASEELRNGVVQLVNSLGGSCRTRVKTGVTYTYKDDKRHGMDSYEARIRLTREIREAIR
SPRLNGRLTAHRFEGCGVFVRNVEKIGNAECLCIMVDHPRHLYVTRGYVATHNTEVVGHM
ALEAMRQGVKTCIASLELKPGILLKRLTRQATCCKMPPVLEIDSAFKFYDERLWVFGLTG
TAKADRLIEIFDYARRRYGIQLFIIDSLMKCGIGDDDYNGQKAFVDSICDFKNKTNSHVI
LVTHSRKGDSEEKPTGKMDVKGSGAITDLTDNLFIIWRNKARERALQRVQSGEKMSEKDE
QLLASPASVLMLEKQRNGEGWEGGVPLFLDEQSHQFLQLESGSPYSYIANMPKSEYDEAW
RQENVTEY
Download sequence
Identical sequences A0A0F6C1U6 A0A0P0ZBM9 A0A0P0ZC72 G3CFJ5 V8FHR3
gi|387881710|ref|YP_006312012.1| WP_001444365.1.19332 WP_001444365.1.21668 WP_001444365.1.23467 WP_001444365.1.25414 WP_001444365.1.25577 WP_001444365.1.25831 WP_001444365.1.26121 WP_001444365.1.30999 WP_001444365.1.38103 WP_001444365.1.40742 WP_001444365.1.44906 WP_001444365.1.48571 WP_001444365.1.48806 WP_001444365.1.48954 WP_001444365.1.52933 WP_001444365.1.57071 WP_001444365.1.58172 WP_001444365.1.63615 WP_001444365.1.80402 WP_001444365.1.82242 WP_001444365.1.84219 WP_001444365.1.88759 WP_001444365.1.93428 WP_001444365.1.97351 YP_009168122.1.94046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]