SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KNC30052 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC30052
Domain Number 1 Region: 51-138
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.44e-22
Family N-utilization substance G protein NusG, N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC30052
Sequence length 178
Comment pep supercontig:GCA_001187945.1:JRES01000579:3991:4600:1 gene:FF38_11457 transcript:KNC30052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPYQQCRARQRARWFTFGGIMLPAVLMIGLSPTLDSVLIASVYGGLSAWYGELLRAIE
HLERQGVTCLAPRYEEIKVVRGRKKKVMEPLFPNYIFVKFEYETIHFSTISATRGVSHFV
RFGREPVVVPDGVIATLVVPNLMKDVTEQLPEKGQAVVLHGGIYEGIKAIYSEPDGDK
Download sequence
Identical sequences A0A0L0CCW3
KNC30052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]