SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KNC30479 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC30479
Domain Number 1 Region: 105-182
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000000196
Family KorB DNA-binding domain-like 0.0042
Further Details:      
 
Domain Number 2 Region: 20-72
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.00000349
Family Sulfiredoxin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KNC30479
Sequence length 550
Comment pep supercontig:GCA_001187945.1:JRES01000511:57383:59097:-1 gene:FF38_10501 transcript:KNC30479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVVREGHNVRDLLEPDYWNSDKARAKIDAIKQIILAGSYLPPISVQVIDSVVYLHDGEH
RLRAYQEIHKDYGEDSWPVTVTEFVGNDVQADYAHVNANKSDAWTPLQIAELLHRPIEKG
ATIQEVASNTGYSASTVSKYLKLRQIPLSMKKDVDSGKLSIQAALDSFENKGTKAALSKE
KVVSNSAINKRVLSVMRDINFDLMDKEDDGMYTMMFTEEQAKALQEFYKHYRTTDDYDYE
QADLPRGAKYISATSLLKSPRQIILNKRLSQVEDGLIPPNDVIDFFASRFGTSLHDGIEG
AWTHKNLAQNLRKIGIPPSVISRIKVNPQPDEIDTDTIPVFFEQRAIKEIAGWHVGGKFD
AVFDGILNDFKSTSTYSYTKGVNDIKYIQQGSIYRWLNPDIVTKDFMNIQMIFKDWMRTQ
SLNNSAYPKAPVAEVRFNLMPIHETELFIKSKLAIIDDLELVPEEELPWCNDEELWRSDT
VYKYYKKSPETQSRATKNFNDLSEATAHRLKEGVGVVVEVLGKAKACNYCATAPTCSQYK
EMLENDDIAD
Download sequence
Identical sequences A0A0L0CG65
KNC30479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]