SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KNC26729 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC26729
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-107
Family Capz alpha-1 subunit 0.0000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KNC26729
Sequence length 286
Comment pep supercontig:GCA_001187945.1:JRES01000960:1424211:1426646:-1 gene:FF38_11409 transcript:KNC26729 gene_biotype:protein_coding transcript_biotype:protein_coding description:F-actin-capping protein subunit alpha [Source:INSDC protein ID;Acc:KNC26729.1]
Sequence
MDQTQISDTEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDALLKEGASHAFAQYNKDQL
TPVRIEGSEHNAVISEFNDLGGGRFYDPRTKQSFKYDHLRKEASDYQDADTDASAEPWRA
ALDIETLAYTASHYRHGVCSVFGKTQSGQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQ
VGAGTAELKGNLKVQVHYYEDGNVQLVSSKECRESVVVTNEQQMAKEIIRLIEEAENEYQ
LAISENYQTMSDTTFKAMRRQLPITRTKIDWTKIVSYSIGKELKTQ
Download sequence
Identical sequences A0A0L0C5M5
KNC26729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]