SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KNC27037 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC27037
Domain Number 1 Region: 61-296
Classification Level Classification E-value
Superfamily L domain-like 1.02e-36
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 294-394
Classification Level Classification E-value
Superfamily Immunoglobulin 9.76e-17
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC27037
Sequence length 931
Comment pep supercontig:GCA_001187945.1:JRES01000940:1176533:1352735:-1 gene:FF38_02334 transcript:KNC27037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPTEIKRLSSPLHSKKSNKMTTHCLRDWLTKVIFATSLLLLLNVQTTTANSDWMQSCSM
CHCHWNSGKKTADCKSRQISTIPNDLSNELQVIDLSNNMIPELRREEFMEASLQNLHKIF
LRNCTIQELNRDALKGLAILIELDLSHNFIKELHVGTFNGLVKLRNLVMNNNQIEVLENH
LFADLHFLSRVEFKNNKLKRIDIHAFGQLPVLSAVYLESNNLTVLRRETFQRTPKLVHLS
LASNPWNCTCELQEFRDFAIAHRLYTPPTDCNEPKHLKGKLWNEIPSENFACMPRILGSV
RSYVEAQSDNITLPCRIEGSPRPNVTWLYNKRPINPNDPRFRILNSVEQQRSESTNMLNS
ELRIFGVRSTDKGSYTCIADNRGGKAEAEFLLLINGDNYSALDGTGGATTFGGMGTTTSD
RETNILLIICLIVTTLLLLLIVVVLVICWYCRRIKTYQKDSTMLSENGLISSKLDKTHNG
SMLEGSVIMEMQKSLLTEVNPVEKPPRRTELESIDGVGSSGDDGHEIKKTLLDETQFGNH
HPRDDETHSVAMSDTTTPRTRHTYIDDTYGTSLPPDLLAFPARVPPTSPSMQSSQSNIPD
QVIYGIRSPPLTSPVYAHMTPHGIYGTTTIAAATPNGFMTLQHPKSRNLALIAAANSRQQ
QSPFVPAPVVYSPAATASVVMKQGYMTIPRKPRVPSWAPSSSNTHSTQLSEFQSPTSPNP
SESGTATTAELTVEPVYDNLGLRTTAGGSSTLNLNKSHLQEPPVRYTMRDRPLPATPSLT
SVNSNQAQQQQQQQQQHSMYQQQQQQPQQQHSTNNMSNNANKIYEPLHELVNQLHQSTTS
DTEPLYGTARHHSGLTIVPSNNNASVNNNTSSSVTNSPSNSGNSITEPKLTKIPPRPPPK
PKKKMSVTTTRSGHGSTSQLFDDEGEDGTEV
Download sequence
Identical sequences A0A0L0C480
KNC27037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]