SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KNC27446 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC27446
Domain Number 1 Region: 840-1139
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.67e-44
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1767-1866
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000584
Family Motor proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KNC27446
Sequence length 2119
Comment pep supercontig:GCA_001187945.1:JRES01000902:1414874:1427875:1 gene:FF38_06515 transcript:KNC27446 gene_biotype:protein_coding transcript_biotype:protein_coding description:Protein abnormal spindle [Source:INSDC protein ID;Acc:KNC27446.1]
Sequence
MSAFEVKVTPTRCKNKKLTESREPTEVIMAPFSGKSIVLFEDVPVTKTAKRLLRIINPSE
DDIEVSVSKSINPEHNISLEWLENSVPAQSEITLEMVWSPQMDVACKETLQFIDNRNFRK
DVMVILKSKPIKQVKSVRKFPTISSGNNTHVKTLRLKSPTSAANKVVSRLTHQQHQQQQQ
QQQLQHQAQMQKKRLTAHDAASKRETIDKNKQQLQPHWNSSVYVANKKNQQPPVKENLQP
PKATLHNHTSPLMERNVYANNKEEALATNLSPHVMDMESENLKENVSPLALTNVLNMIDE
LKFTPATVTLSKPNESRLDSLASLPTPMGPNAITITLTPEAHPDHHRDLKPRCLSVELLD
EALSSEDIHNDIKGTTMVITNKTFDVKLSESLEISCENLNGSSGEGRPSSACSLVINKTT
VISTTPVARPLEIIQEEDNSPTSLTTAPKVENQNSVETPQKGEEDLKRDIKLIGTPLRKY
SESMKDLYQKSPQSIVITQGSLPNLNEMETIKSFEQNRYFIQANSRTDVKTSMQAITAVP
PDNKHKSEQLNESSDQLDCSRMSLISHPDVQFNQNEILAQSSRFNLNEVGLKYRKNSPNI
TKCKTNNTAKRKPTPPKITKKLNSVPETHKRRSNELSFSDSQSMDSVISGSSTTSLRTNS
TKSSYVTVSPPKRQRLETDSNLHKQKTPTNASASIKVKNWSQTQPKKFKLAKTLSLVKKP
LTPRKVKEEPRIKLYEADLYLQPYINPDPFAATTTCDPFLASTMYLDEASVDKHQTDFKK
WLNALVTMPADLDTDSNAKIDVGKLFNEVRHKDLILAPTKEEQSLNYLTNFRLESLRRAA
VELFLSEEMRAPCSKVAVYVQKNALRIRSDRNLHLDVVTQRDILELLLCFNPLWLRLGLE
VVYGEKIHLQSNRDIVGLSSFILNRLFRDKFLEQKYSKAYTLSEEYAEHIKKFTLQKFFF
LLLFLDRAKEKRIIAHNPCLFIKKSPHKETREILLRFSSELLANIGDITRELKRLGYVLT
HKQIFLDEFDYAFHNLAVDLRDGIRLTRVMEIILLREDLTKQLRVPAISRLQRIFNVNLA
LKALGEADFQLKGDITANDIVDGHREKTLSLLWQIIYKFRSPKFHAAARVIQKWWRNSWL
KVVIQRRIRFKEEQRREAAAVVIQSLYRGFMTRRFVDKYRKERVQAALVFQKYIRCYLAR
KRFLKTVHCTVVIQKWLRSVILGRECRENFLQWRKSAICLQQHWRNRKQARVLREQAALA
KCKYQQQRNKAATLIQASWRGYKARTQFLKIISAILVFQRKFKALQLMKQHYGDYLKLKK
ATICIQQRFRAKMSMKKEMANYQLIRTRVIYIQRLYRATILMRQQRKEYLNIKSKVICIQ
QKWRATLLARKVRVEYLAVQYYTLIVQQKFRAKKQMEIERKKYLQLQTCIINVQRRFRAK
LEMRLQYTQFQRKLQAIKTIQSQFKAYKAMRYQRAKYQGTREAVLCLQEHFRGFLKMKEE
RKRFLQQKQAATVIQIAYRTYRLMKLQKGDYRRIKQAVICIQRRLRATLVMRAQRKEYLR
QRKLIIFIQIRYKAKLLARKVRLQYHQQRNMIIALQRRFRAQQLMLKEQQQYQVIRSRII
CIQTYYRSHLQRKQEQAKYQLQRSSAIKIQTWFRAVLKMRMEKQTYQRVRSSSITIQQRW
RATLEAKKQRTTFLKTIQKIVYLQRLIKATLVMKMEREQYQKLKEAAIVIQKRYRARREM
LQIRSQYQLIRSLIICIQRHFRAKRAMLKERNDFVLLKSTVIHLQQKFRGRQKMRIDREH
FLQLKTNIVEFQAHVRGLLARRRFQALMTPEMMELLRQKKAAKIIQRFWRGYRIRKRFNN
VRIKVIRKNIALLKETSNTVNSIKFKVQDAVRLLRGRFSASEALHVLMRLDRISRTVPHL
LMCRSDFISTFCYGIMAQAIRSEVDKQLIMYCSRIILNLARYNSTTANTFQEGGLVTIAQ
MLLRWCDKDCEIFNTLCTLIWIFAHCPVKRKIIRDFMTTTDAIYMVRETKKLVARKEKMK
QNVRKPSVPTSMLSSSSTTSTSIRGLSQQQQQQQQQNFSSRALPSLEPDYGVIRNKPYTF
ISSVYAFDTILYKLGIDIF
Download sequence
Identical sequences A0A0L0C5D6
KNC27446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]