SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KNC27670 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC27670
Domain Number 1 Region: 1410-1657
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000017
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number 2 Region: 1688-1931
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KNC27670
Sequence length 2172
Comment pep supercontig:GCA_001187945.1:JRES01000866:113449:122849:-1 gene:FF38_10201 transcript:KNC27670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMRSWKKVLLQWITECGFMDRNYFNIEQSDIDVFYQNFSLQHQKTATDKYKRLGDFLKE
FYPSFEINFDDENCLSSADYIYVYSLLLHFSCVKHPETVFHEICQRLPDNAQQCIAAFFK
ELLDTEPITKEALRHAIAEVANSQCSPPRLNDSFSSSITSVSVGGMSAASFARCESPLKT
PKRCAGPQRISPSTPKSYLLEERTRELYNLRAQLETERYEKGLLEVQIKQNEDKIQKLNH
DHKRLLQQIQDLKNDILVKTTDGSANRDGEENQVQKRLLKELSKKEQEIIKLSDNVRTLR
EEKALVEEKLILAEKQIVLCMNRIKELDFKVDELKDELEKKDGHIKYLTDSKMELEQFIS
ETRSSLGEHGDLNASVDCMDSSYIRSGHNTNCSNSLSPENLGASVIDVQLREKEHENQLL
KEELQNVKREHKRLAKHLTKLTQEFDLPIDASSPNNSEESEAESDREERRGLSEDSSPEE
HISVVEQFNIFTSCMEKIDKFHKTEKNKIKQLEEDSRQLQTENEDLNRKLQELKEEVKEM
KEQLQAKEKLNQEIEKSKLEINLKWEKSQQELKEVEEQKDKLYKNVQSLEQDKATLNENI
VELKTLIELQQKECKVLLDNNTQLNEQEESLRKQIQQTEKEFAEKTLQWEQELKQLSDKM
SQQIEDIERYKQTEQTIKANYEQMVVDNEELKKEARQADNHLAEMRNELQEKEQQLAKLG
KDISELGQKNEVLEQNINKLMEEQEKEKLTNNNNQTEMEEQLRKLKDQLVKTELLKDSKQ
HECDLKQQKLQELENKVMALVKLFNISNTEKDLYENLNEMEQQLKEIFKQNEQLNSKVLK
LQETLHENDTKIQELSQDLQENTNALMQTQREVLKLKEENSQYEQKQQELLQNLQEKSNA
IKQSQEEILKLQQQNSDCEQKIQKLTQDLQETTEAIKQTQEEVLKLKEENLSCEQKIELL
QREKISIMEKSKQDLQAKEQELQEHLREALEEYEASMERIAVELKSEKEHHNNKEMELIL
KAAEHNEGKKQLQEAEQKIQQLQREQQILQEKCQKLQQFELKVQECSKENEQLRHEIETF
KQQVTQNALRLLEADKALSEFMELTKEQNTAKSEVEVLKSNLKEKEDVVKELELKLKQQT
CYEEQLEQLKHQLEEQNELVGTVQEQLEKLSKDKERLSQEAEEKAEQILKEQQDKLMLLQ
SLEKSTDQLKLANEEKQQQTTNLEQKFQELKEQFDGITLQNTKLQGDLVEREAELRLAMD
EQQQEKEDFQQKLASEQEKLTQKTELLEAIDMSLMELVAIMENNFNLNQELFKQDVLPNV
FNFKEAEGQQNIKKLRKHLNHILAKQQKLNEQLKDLAVEKEESNNTINTLRSSNNDLLNK
LTQQEKTLKELKEQLDNEELIVEKKVFHEVKRLEGDLLNLEKVNERLANENVKIQVTLGN
IEQEFKDCKCKNETLEEESLKLQEEVRSKTLLLEKLQQEDKKLQMIIKEKSQHADKLLEK
CKHLELQLKDKSSKLQNLEKDYQELKEKANRNQQKLSHYQQSQQNHLAEQKKLQEKLKQL
QTAQDSLEMEVENKNKDLLNLKNKNSELSQQNQELEQQLNLTSKKLDEMLTNKLNAETKC
EQLQSELQQLKRDLEFIKSQQQTQQEDYSRLTQEIDSLKVDKQHLRDEVYENKQTLQKSN
DNVTQLIQQISSIRLEKEAALEENSLLRKQLEETGKNQSSSETKMKSIIEKSQEFERKVL
SAENELKSLKVQLEKSENNTEKLQAENKKLRDSQESTTKRIEKMALKLGDSQARSVKLER
DNEKLTRTLEAHATTVEALQKEKDLLQAEAKTLKERLSRAERGHEQLAAKVQNLEHLNTS
LQEIKQKLEASELDFKQKLTKLERMRDMNEEKIRKLTNSLSNAENVNVKLNLEIGALNSQ
LQEVKVEHNQEQSQQLEELTHQLTEAQELNQKYQDIQEKLKIEINNLKEENTTLNDQLSK
ASLSLQITSQKCERFAAEMEQIRADMLIMRQEKSQIELQHETSIQKLNQFESQNTKLVYE
RKNLVKSLEQKIAHLEEELAAKSKEVSDLQHEVDILRENSETNASLLHQNTAANLSELDD
LRTKLSLAEDLRQKEQQIISQLRLDNQILHTKYQESKQRALDANKMSEERIKENRLELEG
KLEKMKNKMVSC
Download sequence
Identical sequences A0A0L0C5V7
KNC27670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]