SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|105456|estExt_Genewise1.C_30148 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|105456|estExt_Genewise1.C_30148
Domain Number 1 Region: 243-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000331
Family C2HC finger 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|105456|estExt_Genewise1.C_30148
Sequence length 499
Sequence
MLLEDLRNTREDLERLEQAIAERSLEDPKHIRDRLARDHQISAFLDRIKSQSNRAVDLYK
DNDGSRLREIQSISTGDTFDEFYKQLNGIKDFHKRYPNEPVENLERAYKRRAVGEDVPIA
SEIDTMFTGEEAFGRYFDMNALHEDYINLPGSKRRITYLQYLDTFDEFEGMPRPDKLKDQ
YFQYLGNLATYLESFMRRIKPLEDLDRLFIGFDEDFLKAWEKDEISGWQLNTKSTADGPA
TEGTGEGMWCADCEKEFKNDNVYKAHLSGKKHIKNAEARKQRTADGEASSNGSSNATSVH
RLKEKAVAEREHRIRKLASAMQTERSDTRANVERKQGMTDKERQQELAALYVETQDLQNA
DPAAENEEEDEESKVYNPLKLPLGWDDKPIPFWLYKLHGLGVEFPCEICGNYVYMGRRAF
DKHFGEARHLYGLKRLGITNSSMFRDVTGIQEATDLWGKLQTDRKQESTATDQVVQMEDG
EGNVMPEKVYYDLQKQGLL
Download sequence
Identical sequences A0A074ZID2
XP_013347051.1.23603 jgi|Aurpu_var_sub1|105456|estExt_Genewise1.C_30148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]