SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|1146|gm1.1146_g from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|1146|gm1.1146_g
Domain Number 1 Region: 163-229
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000137
Family Homeodomain 0.0015
Further Details:      
 
Weak hits

Sequence:  jgi|Aurpu_var_sub1|1146|gm1.1146_g
Domain Number - Region: 390-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00235
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 82-118
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00384
Family Zn2/Cys6 DNA-binding domain 0.0051
Further Details:      
 
Domain Number - Region: 601-659
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0484
Family Centromere-binding 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|1146|gm1.1146_g
Sequence length 942
Sequence
MSTLQEEADLGEFFDFQNAVSDGSSMQTSSAIADPDHISHTYNDNNDNNEATLTIFENEA
AEAADYSNFSRWIPRFIQPDGPCTYCRDRKLNCYLSYGKVTCTACDTLFRPCSFVKPHSH
AAPEVPEGESSMGFVDTLHPVIEDCCQEQGKLTGVRSLKSMPDKKSSSRFSKAALKVLRG
WLDEHQANPYPTEDEKEQLSRTTGLRVPQINTWLANARRRGKAGVKNKAAMDGLLQSTTT
SLPPTAAIGIPGATEIEINKWSDMNPLERWKHSPPQNEPAPFNAIADALDRKDLPDYAEE
SSSPSTLGWQGLGSSRDDSRSSNRRAASVTSLEKSTSNSAASSAAWSGSRDSWGSYSSFG
SSLNGRKERRRRRKMPGTTLKKPSNDKSLQKERLYQCTFCTDTFLTKYDWVRHEKTLHLS
LEKWICCPLGPETLDSASGQTICAYCCELEPTKDHIESHNHRQCLDKGFQGRTFYRKDHL
RQHLRLVHESKLLPHMEAWKTSLTNVNSKCGFCYQRFTVWSERNDHLAIHFKNGAKMSEW
KGCRGLDPAVAALVTSAMPPYLIGIETNSVNPFTATNPMRCMTVQAHLESGGAPATCWEI
LTVRLGRFAKEQTDKGVVLTDEMLQTQARRILYDSDDAWDNTAADNPEWLDLFKRAHALD
YIPSEVSGIGKNVPEDLEIYTDLGMRIPLSVQAARGMSLEYPPVGLPTVQGPLEASRSTM
QQEPTGATNIACTRWLLPSSRSSLSQPSPQWGSELATPATYQSQGSTPLQLDTPHDLNLD
NCFDADIDAILAEAGYQAPSEAHAGDLARQQNAMLAQQHGLDASFTPRKAQQQLAEMNAA
MAVLTEQAVLCDVPTSGQSTSTLDYSTFGMETDLSNLINSTATSSSDNLFATTWDGKDQF
GLDNAFTAAAAEAGYTATDMTMQDLDMNDIQFGDMDFSMGFQ
Download sequence
Identical sequences A0A074YPF9
jgi|Aurpu_var_sub1|1146|gm1.1146_g XP_013347889.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]