SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|232745|CE118631_8088 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|232745|CE118631_8088
Domain Number 1 Region: 8-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000124
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|232745|CE118631_8088
Sequence length 764
Sequence
MLSNPSDQERTFECPTCDRSFARLEHLQRHLRTHTKERPYICFCGRTFTRQDLLKRHDRR
AHAARAEPIGKEAPTADYAPRNHTLDSNITGLPDTRKPKLPSASACVQIEHGIEPHDNSP
GDGFSSEFQLPRVVQAEGIMPDANTLIAASDQISMDTYLDIIDHNDLNLDWNNMELDETG
ILFNTQAGLDINHADKSLHLNNSAQIAAANIGWNVSEEQRKDYENLQIVVNQRLPHLILP
SYPTLRRYIDGYIDGFNQAFPLVHVPTFDLGTCSLELVLAIAAIGAYERFEPRNSVELFD
ASRTIARENLRMSQTCREKQKTPRSTRGLSPPEYPTASMVGTQDTLTRTAGIDNLTALLL
LSFLGLLGADSTLYREVLDFQNDMIEVVRYFGLAEQHSNTTTWQAWVQEEQERRTKFGLF
CFLNLQTVLHDVPSPILCSEWQLRLPSSVESWEAANGEDWIVELESPRVPFQTVFRSLLA
TSDNPGTSLVRSLTPFDCTILGLTLLQRIYYIQQLQAATGEVLREDDMRSLQGAIQGLES
ASLEHQVQPSKCGQAKLRISDIVAYQHIAYMRLHANLSGKRNIQSRDSEQIARSFYDVPL
QACGSFSPGPLWRSINQLQVVVDLGVAYVSRDIGCFSSVPQALSCLHHGVFLSRWFFSLA
SEHQKDPLAPEELQIIDHTRSLMQEVVISAPDISSSLGCMDFSEPKCCLELGILVLKIWA
YILETKVKWPLVTVLGHSMSLYADMMSSARSHLEARLLHQGQAG
Download sequence
Identical sequences A0A074Z853
jgi|Aurpu_var_sub1|232745|CE118631_8088 XP_013343660.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]