SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|24574|fgenesh1_pg.0_#_177 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|24574|fgenesh1_pg.0_#_177
Domain Number 1 Region: 280-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000143
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|24574|fgenesh1_pg.0_#_177
Sequence length 342
Sequence
MEVAAYAPYRQHTFHPDFQSHYSQYPESRGQISHPVAVHPAMVSQYQEVRRAGQRHAPQQ
HSTQATSSQDDMNKPSLPSISNLLGIADGDRTSLAGQESGSPPQQSQAHYSTAPTESSFG
QGYVTVAEPTNTTRGPLPPSPPALRSDSVVETAPSPTLMTGQSYLVGSSLNNMEPHQQRV
MPMKRHSVPMPNGGMYATSPYAMAAYNSSPSAMSTSSYYSADGVYGMNGVYQQRPLPSNF
PPIMSGPVIAGSTVPAPNMWEHHHYIAPSNQATYPQSQDRYVCQTCNKAFSRPSSLKIHN
YSHTGEKPFKCTQPGCGKAFSVRSNMKRHERGCHAGSSSIMA
Download sequence
Identical sequences A0A074ZPI9
XP_013348722.1.23603 jgi|Aurpu_var_sub1|24574|fgenesh1_pg.0_#_177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]