SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|25626|fgenesh1_pg.1_#_417 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aurpu_var_sub1|25626|fgenesh1_pg.1_#_417
Domain Number - Region: 296-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0172
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|25626|fgenesh1_pg.1_#_417
Sequence length 325
Sequence
MNDEQRIARIGELFARVDPQVLIIGFAPGTHDEIVNAHINIMNAIAQFYEILRSYHLHDF
LKHGNYLHDWLTAGESDPNLLLSKIVYDLSDNIEIITTHDLEYACIVPLAEYTPHMVLGR
QAPFPVITPPSFLPSYIPTPTILPSYVSDPARRLVLRYSPEPEMLEGDAPNLDPQVLEGF
VPNLAPVDTEDVTIAMDTEDATMSDVENNPSVDVEMPPPARSDDPLAPVYPEMPPDDLPT
SPLFSRPTPGPVPMSPAAVLPAFTPVAPAPVLPTTTNAPLVEIRDTSIPIDQRRVFICIL
CARGFTRAGDLARYWRTVHRGLQQQ
Download sequence
Identical sequences A0A074YUA5
XP_013348042.1.23603 jgi|Aurpu_var_sub1|25626|fgenesh1_pg.1_#_417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]