SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|2651|gm1.2651_g from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aurpu_var_sub1|2651|gm1.2651_g
Domain Number - Region: 3-34
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0188
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|2651|gm1.2651_g
Sequence length 170
Sequence
MAFPCTRCPLAVDYLSEHLKVHDLPYRCSTCAQAHFYTPARLRGHHASLHQGRTISLAEE
RTARAINAALAVERRGGGYVAPPGTFSHFAAGAGAAPPPAAAAPGPLLLPGTVAPLAGPV
AVVPPPPPPPPPPPPPPPPVTAPGPVVRVPMWTWGLDGEREEIPGYFVDA
Download sequence
Identical sequences A0A074YIV5
jgi|Aurpu_var_sub1|2651|gm1.2651_g XP_013346119.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]