SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|27243|fgenesh1_pg.4_#_255 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aurpu_var_sub1|27243|fgenesh1_pg.4_#_255
Domain Number - Region: 225-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00852
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|27243|fgenesh1_pg.4_#_255
Sequence length 526
Sequence
MDMSAFNTPDMQDFQQSYMNSPAVTPGITYESPHSAGPGSPYPDQSASAAMTANSQEMQN
WFAHSARRDSRSKKGFPRRRSLYSRNSGVPVAIPKHQNAEWSALDPLQRWQNSPPENEPA
SISAISHAVASTDIDRHLTVGSANSSRVSTPGIEPAGFGYAARRTSRPASISSLESGTSN
GSMDSILSCRSGNSRISASSNQRKNARSKVTKSRARSGPGPGKDDRLFQCTFCCDTFKNK
YDWVRHEKSLHLNPEQWICTPDGEVVPCPSTRDSLCAYCLVPQPSKEHLEGHNSTACAHK
NLESRSFKRKDHLIQHLRLVHKIDTIPAIGEWKPPELCIKSRCGFCGAEMEDWKARADHL
SKHFREGKKMLDWRGTHGFEPHVAQQVTNSMPPFLIGSESKTPVPFSATNPGHSELLAQI
TSRAAFNDAANHTMADPSPSPDNGQGEGNQPFKTAWEILTFHLGRFAQEQIKAGVVPTDE
MFQQESRRLWFDSDDPWNQTFADDTQWMEIFRQEHGLHDGNTPDAA
Download sequence
Identical sequences A0A074ZH69
XP_013346265.1.23603 jgi|Aurpu_var_sub1|27243|fgenesh1_pg.4_#_255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]