SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|292926|CE178812_6928 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|292926|CE178812_6928
Domain Number 1 Region: 14-62
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000238
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|292926|CE178812_6928
Sequence length 775
Sequence
MSSNTSLRRTNPSKPFHCSFCNRGFARHEHLKRHITTHTNEKSYACFCGKAFARKDLLKR
HEQNGKHLVTPPSDETPPAQSIQTECNGIEIESSTATPEHLGRGQMMMLDGHLPQQSAYP
LPAYAGGSRAPDATDLFAPDADFTYSNDFGDFFNFIDTMGLNAGLDFLHDPEFNMHDPSF
SGDGSLYSTAEALQKPSQSLNATAAVPPSHRIRPMEDDFDELGPVPCPWRVHEEQRASIA
AALLPFQDKLTGFKLPSRLMLGRYVTAFFEDYRDHLPIIHPATSTPSQYYKYPGLFLALT
AIGAVYRYENKTARELFRAGKEVVLASWQDEDTSRLDEQHLSDQWTKKLRNVQAALLLDK
FAFCQCDLRSAKDTLTIQSLLAGYLRSSSSIATFSPGLGRDNWNEWVLHESFRRTQLATF
FVLNMHTVFFNAPPMVLSSQLDVDLPCSTAEWMAPSACAWADVRSRSLDNVSFRDAFQAL
FSDSPAGKEVNYSPFANLVIVHALVQRVYLARQLHNNHHGALRDADMDEIGLALKQWTAI
WKQAPESILDPLNPDGSNSLTSTAFLGLARIRLYSNYTYSMRFGSWDAKQIASSLFEDVL
PARSSNMTLALLHSVHALNLLVKFGIRYISRIMFVRWDSQNLFYYLEAAVFLSKWLEELA
NTHHANHAAEAELKVVGIVVRIVEEVAASLEPFESLGHIYTLNDLDHGDLPAMLHVLSSQ
LARSWAYVFNTSGSPWPIVRFLGSIIDHYAGMLEKQNMLRRTASSTADQGMYRGS
Download sequence
Identical sequences A0A074Z547
XP_013342701.1.23603 jgi|Aurpu_var_sub1|292926|CE178812_6928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]