SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|29899|fgenesh1_pg.11_#_278 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|29899|fgenesh1_pg.11_#_278
Domain Number 1 Region: 23-63
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000031
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|29899|fgenesh1_pg.11_#_278
Sequence length 293
Sequence
MADVRSLLRNERVSRRINHPHANYSDSGKLLCAVCNLHIKTESLWEKHISSPQHTARLEH
LRANSPPAPTQTKKRKAGESGDEGRKRVKAVPGGFVPEGFFDASEEGADEVEEGVEDVDT
APGPSTPAVTIADSQPVVPAPPLAPDVNEDEWAAFEREMAAEQHTALPIISASATISAAP
VTAEESAAQAREEQNAKRTAREIEMEADNEDAALALQQEFDDMEELDERVRRLREKREAL
RLAKQQDTLPDAPAPIQEPPQQDTKVTRDDKEEEDDDDDDDEDEFDDWTFGAR
Download sequence
Identical sequences A0A074YM55
jgi|Aurpu_var_sub1|29899|fgenesh1_pg.11_#_278 XP_013343472.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]