SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|30794|fgenesh1_pg.15_#_9 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|30794|fgenesh1_pg.15_#_9
Domain Number 1 Region: 37-87
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000968
Family Classic zinc finger, C2H2 0.064
Further Details:      
 
Weak hits

Sequence:  jgi|Aurpu_var_sub1|30794|fgenesh1_pg.15_#_9
Domain Number - Region: 91-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0253
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 3-27
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0308
Family Plant C2H2 finger (QALGGH zinc finger) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|30794|fgenesh1_pg.15_#_9
Sequence length 641
Sequence
MSYDCETCDREFYSWRAAQQHMDALNHHGCGSSSSEDEDGFECDRCSRTFISWDSCRQHM
NAMAHWFTDLCETCGRRFVNANVAEQHMGALGHLSCSACDRYFQRNADLTQHTNFSIHRN
LAAPVPNIQPPSTPAPVLAPQITTYHTPSAPVLTPHVTANPNPPASSRSSLLPALPLVTP
EAAANPPTFVAPAPARPLQITRPPLPAPVTLYIPPVPPNISTGTITGFQRSDVTPPPVFT
SAILPTPPVQPKLLIATAPNFHLGDITPPPTPAPALTFESSDLPSWPVARLVGARPVGPA
PIPLSVSVPVDVFQSTIVPDPTARTLPQVSIFTPPLDIASSPAAENIFLPTVAATSTVVL
SPKVDTLPLDSTVVSTSTIVSGPIVDTVPLLPTVITSSTIESGPTVETTPVAPTDVSNLA
IVSGSTVDTTPGISIVVQYITCDGFTQTQNSVVWSRSEIKSQQTEPYTTQTCPYFTRSEI
RSQHTVPTDLVSLDRRPSFSWSQIVSQHIDPRGPPEKTIACKFCRGTFEAFSECAQHLET
SSCPVRPGITRMTMHRCLRGMDQTGKYCIHALQYRGILLYICPNKTGNCGARPLPSLAAL
LSHLEGESCSSRELSNSREVADSFVNLVFGSPIKANRRLRH
Download sequence
Identical sequences A0A074Y7P1
XP_013342253.1.23603 jgi|Aurpu_var_sub1|30794|fgenesh1_pg.15_#_9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]