SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|30813|fgenesh1_pg.15_#_28 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|30813|fgenesh1_pg.15_#_28
Domain Number 1 Region: 466-535
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000193
Family Ankyrin repeat 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|Aurpu_var_sub1|30813|fgenesh1_pg.15_#_28
Domain Number - Region: 53-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00667
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|30813|fgenesh1_pg.15_#_28
Sequence length 671
Sequence
MSQTTEPLLQRPLYVFDLPQELLTTLELKAQNNAAVSVPDDADSTATSSGRRGENEDGPS
SATSCGLCGLSFPSVQEQRSHVRSDLHGYNMKQKMRGLKAVGENDFEKLVGDLDESISGS
DSDDSASSDDGGKKDTTLSALLKKQANIADADFDAFTTTKVKVGAGKPPLLWFSSSKLPS
NVALGVYRTLLPPAIQVGDPTTILQTIKDKQLSPKPPPTQPTSAPTEESGGVPLPRSLQP
DTSAAGPHYFLCMIGGGHFAAMVVSLTPKMTKKAGVEDRTATVLAHKTFHRYTTRRKQGG
SQSANDSAKGAAHSAGAGIRRYNEAALIAEVRQLLHDWKVWIDSSELVFVRATGTTNRRT
LFGPYEDQVLKSRDPRIRGFPFATRRATQAELMRSFVELTRVKVSTIDEAAIARKAQEEE
AARQAAEAKAAAKPATPKPVKPSKEEEEATLHTTQLQALVRRSKAPALVSYITSNNLSPN
FTFFPKDNPQNHHAPTPLHLAASLNAPALISSLLLKVKADPTVKSAEGKTAFEIAGDRAT
RDSFRLARSELGESAFDWDSAGVPAALSKADYDVRVQREKAEKAAEDAAEQQRRKTETER
LRNEDKIREEQGKEKKFGKGKTLAQVLPEKTAQEKREEEARGMTPEMRMKLERERRARAA
EARFKAMSGGS
Download sequence
Identical sequences A0A074YI18
XP_013342259.1.23603 jgi|Aurpu_var_sub1|30813|fgenesh1_pg.15_#_28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]