SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|31004|fgenesh1_pg.15_#_219 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aurpu_var_sub1|31004|fgenesh1_pg.15_#_219
Domain Number - Region: 104-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0214
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|31004|fgenesh1_pg.15_#_219
Sequence length 235
Sequence
MSKRTRQDSSDDCHRSSSPVDESSLPPGKYAQLDHSTAPDASTFITCMLPPHDPVNFSTY
HDYEAHYHKTHVNRCLDCGKNFPTDHFLSLHIAERHDAINLVKRDRGDKIYRCFVEDCDK
VCRTPHKRRMHLVDKHMFPQDFDFYIVNHGSDNRTSLLLGNTKAHAKKQNATASQKAVTK
NTAEDADGLHVMNSSQGGDRDVSMDVVVESMAALRFVPKSVTFGRSRQRGGFSET
Download sequence
Identical sequences A0A074YIL3
XP_013342301.1.23603 jgi|Aurpu_var_sub1|31004|fgenesh1_pg.15_#_219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]