SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|31088|fgenesh1_pg.16_#_56 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|31088|fgenesh1_pg.16_#_56
Domain Number 1 Region: 225-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000189
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Aurpu_var_sub1|31088|fgenesh1_pg.16_#_56
Domain Number - Region: 162-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0235
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|31088|fgenesh1_pg.16_#_56
Sequence length 255
Sequence
MDGFNYPNRLVHQQYTESFGSPVLLCSSPDNQIIDHCYPEEYQPMFNTCQSPLFRSMQPM
LPTQHEHLSGQCTPTWPDSYPYQPVFMDYKDPYNFGVVRSSPSLLPSIEQTCLSRPVSRA
PSFRSDTSSSWVSCPRSNPSRSSSPNAGEMSKYGAPSEDGTWRCAYPGCTSKSVFRRGCD
LRKHYRRHTKTLFCRHIGCRSASEGGFSSEKDRARHEAKHDPKIVCEWDGCSRVFSRVDN
MRDHVRRIHRRKLVK
Download sequence
Identical sequences A0A074Y722
XP_013342008.1.23603 jgi|Aurpu_var_sub1|31088|fgenesh1_pg.16_#_56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]